KEGG   Desulfotomaculum carboxydivorans: Desca_0127Help
Entry
Desca_0127        CDS       T01498                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desca_0127
   01230 Biosynthesis of amino acids
    Desca_0127
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_0127
   00051 Fructose and mannose metabolism
    Desca_0127
   00562 Inositol phosphate metabolism
    Desca_0127
Enzymes [BR:dca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desca_0127
Exosome [BR:dca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desca_0127
  Exosomal proteins of bladder cancer cells
   Desca_0127
  Exosomal proteins of melanoma cells
   Desca_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
131463..132215
Genome map
AA seq 250 aa AA seqDB search
MRQLIIAGNWKMHKNIHEAMEFLQELRGKLGSTPVEAVVCPPFTALAPVAEALKGSNIAL
GAQNMHWEKQGAYTGEVSPLMLREIGCKYVILGHSERRQYFGETDESVNKKVKAALEHGL
VPIICVGETLDQREAGITEQVVATQTTGALEGLTPGQVAGLVIAYEPVWAIGTGKTASEK
DAQQVNRYIRKVIADQYGAAAAEAVRIQYGGSVKPGNARALMSQPDIDGALVGGASLQVD
DFVGIIENSL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagttaatcatcgccggaaactggaagatgcataaaaatattcacgaggcaatg
gagtttttgcaagaattgcgagggaaattgggcagcacaccggtggaagcggtggtatgc
ccgccctttaccgccctggcgccggtggccgaagccttaaagggcagcaacattgctctg
ggcgcccaaaacatgcactgggaaaagcaaggggcctataccggggaagtttcacccctt
atgctaagggagatcgggtgtaaatatgtcatcctgggccactcggaaagaaggcagtac
tttggagaaaccgacgagagtgttaacaaaaaagtgaaagcagccctggaacacggtctt
gttcccatcatctgtgtgggagagaccctggaccagcgggaagccggcatcaccgaacaa
gtggtggccacccagaccacaggggccctggagggtctgacccccgggcaggtggcgggc
ctggtcattgcctatgaaccggtctgggccatcggcaccggtaaaacagcctcggagaaa
gatgcccagcaggtcaaccgctacatccgtaaagtgattgccgaccaatacggcgctgct
gctgccgaggcggtgcgcatacaatatggcggcagtgtgaagcccggcaatgccagggcg
ttaatgtcgcagccggatatcgacggcgccctggtgggcggcgccagcctgcaagtggac
gactttgtcggtatcattgaaaactctctgtga

DBGET integrated database retrieval system