KEGG   Desulfotomaculum carboxydivorans: Desca_0148Help
Entry
Desca_0148        CDS       T01498                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desca_0148
Enzymes [BR:dca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Desca_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
159729..160940
Genome map
AA seq 403 aa AA seqDB search
MDMQVNVRFIDNLEQAKAEIRAIGSDTAGIGLMAPKGVHRVLKISGVNPKQANIIKQEML
SKGGEAAITRGAVDHSVETTDVLLMATLKQYRAFIDKLKMQPFGLAKLAASISEALDNLE
GRKVRVLNCRGKELEIGRRTLVMGILNATPDSFSDGGRFTEPAAALEQAHRMVEDGADII
DLGGVSTRPGYSEISSEISIEEELSRVLPVLERLVQEITVPISIDTWRAGVAQEALAAGA
HIINDQWALRGDPELAGVVARYQAPIMLMHNGQDSNYRDMMAEIAGFLRQSIEIARQAGI
PREHIIIDPGIGFAKTYEQNLEVLRRLKELTVLGCPILLGTSRKSVIGNTLHLPVNERVE
GTGATVALGIACGADIVRVHDVKEMVRVARMADAIVRGGAGEG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcaagtaaatgtcagatttatagataacttagagcaggccaaagctgaaatt
agggcgattggcagtgataccgccggtattgggctaatggctcccaagggggtgcaccgg
gtgttaaaaatctccggagttaatcccaagcaagccaatataattaaacaagaaatgctg
tccaagggtggggaagcggccatcaccagaggggcggtggaccattcggtggagaccacc
gatgtgcttttgatggccactctcaaacaataccgggcctttattgataaattaaaaatg
cagccctttggcctggctaaattggcggccagcattagtgaggccctggacaatttggaa
gggcgaaaagtccgggtactgaactgccggggcaaagagctggaaatcggccggcgtacg
ctggtgatgggaatattaaacgccaccccggactccttttcggacggcggccgatttacg
gaaccggccgccgccctggaacaggcccaccggatggtggaagacggggcggatatcatt
gacctgggtggggtgtctacccgaccgggatactcggagatcagttcggagatcagtata
gaggaagaattgagccgggtgttaccggtgctggaaagactggtgcaggaaataactgta
cccattagtattgatacctggcgggccggtgtagctcaggaggcgctggctgccggtgcc
cacatcatcaacgaccagtgggcccttaggggtgacccggagttggccggggtagtggcc
cggtatcaagcccccattatgctgatgcataacggccaggacagcaattaccgggatatg
atggcagagattgccggctttttaaggcagagtatagagatagcccggcaggccggtatt
ccccgggagcatatcattattgacccgggcattggttttgccaagacctacgagcaaaac
ctggaagtcttaagaagattaaaggaactaactgttctgggctgccccatcctgttaggg
acttcccgcaagtcggtgattggcaacaccttacatttaccggtaaatgagcgggtggag
ggaaccggtgccaccgtggccctgggcattgcctgcggggccgatattgtccgggtacat
gatgttaaggaaatggtacgggtggcccggatggctgatgccatagtcagggggggagcc
ggtgaaggataa

DBGET integrated database retrieval system