KEGG   Desulfotomaculum carboxydivorans: Desca_0311Help
Entry
Desca_0311        CDS       T01498                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desca_0311
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Desca_0311
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desca_0311
Enzymes [BR:dca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Desca_0311
Exosome [BR:dca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desca_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
327408..329042
Genome map
AA seq 544 aa AA seqDB search
MKRIFKTGVALALSLSLLSSQLIWAGVNTAEAAGKKVKNVIMMIPDGMSVDGTTLARWYN
GGQPLAMDEMACGLVRTYSSDAAIADSAPAGSAFATGYKSHTGYVATLPEVANMPGLRPI
TEEDKNRPVATILEAAKLAGKATGVISTSETMHATPADFTAHSTSRKAYDDLSEQQVYNN
VDVVLGAGWKFMDGNNRKDKTDLISVIKNKGYDYVTTPAALQASKSNKIWGLFAPEALAY
EMDRDPAKEPSLAEMTGKAINVLSQDKDGFFLMVEGSKVDWAAHANDPVGVISDILAFDK
AVKVALDFAKKDKNTVVIAVTDHGNGGLTIGDAGTTKTYDEEPLATFINPLKKAKLTGEG
IESKLNADRSNIKEVMATYFGITDLTEAEIAAIKAAKPGSMNYAVGPIISKRAHIGWTTG
GHTGEDVVLYVYAPNGVDRLTGVVENTDIAKYMEEVLGLSLTDATKKLFVDANAAFKAKG
ASVELKDSGNNNMVLVVKKGATTLELPINTNIARMGDKKVELSGVIVYNGGRTFVPQDAV
SLIN
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgtatatttaagacaggtgtagctctggccctgagcttaagtttactttcaagc
cagttaatctgggctggagtaaatacggcagaggccgcggggaaaaaagtaaaaaacgta
attatgatgattcccgacggcatgagtgttgatggtacaacccttgccaggtggtataac
ggtggccaacccctggcaatggatgaaatggcttgcggtttagtaagaacatactcatct
gatgctgccattgctgattctgcacctgccggttcagcatttgccaccggttataaatct
cataccggttatgtggcaaccctgcctgaagtagcaaatatgcctggtttaagaccgatt
actgaagaagataaaaataggcctgtagcaaccatactggaagcagccaagttagccggc
aaagcaaccggtgttatttcaacttctgaaactatgcatgccactcctgctgatttcact
gctcactccactagtagaaaggcctatgatgatttgagtgaacaacaagtttataataat
gtagatgtagtcttaggggccggttggaaattcatggatggtaataatagaaaagataag
acagatttaatttctgttattaagaacaaagggtacgattacgtcaccacacctgcagca
ttacaagcatccaagtctaataagatatggggactgtttgccccagaggcattagcctat
gaaatggaccgggaccctgctaaagaacccagcctggcagaaatgaccggtaaggcaatt
aatgttttatcacaggataaagatggtttcttcctaatggtagaaggaagtaaggttgac
tgggcagcccatgctaacgatcccgttggagtaataagcgatatcctggcctttgataaa
gctgtaaaagtagccctcgattttgctaaaaaagataaaaatactgttgttattgctgta
acagaccacggaaacggtggcttaactattggtgatgccggtacaacaaagacatatgac
gaagagccccttgccacttttattaatcctttaaagaaagctaagttaaccggtgaaggt
atcgagtcaaaactaaatgcagacagaagtaatattaaggaagttatggccacatatttt
ggtattactgacctgaccgaagcagaaatagctgccattaaggcagctaaacccggcagc
atgaattatgctgtagggcctatcattagtaagcgtgctcatattggttggaccaccggc
ggtcacaccggtgaagatgtggtgctgtatgtgtatgcgccaaatggagttgatcggttg
acgggagttgttgaaaatacagatattgccaaatacatggaagaagttttaggtttaagc
ttaacagatgcaaccaagaagctttttgtagatgctaatgcagcttttaaagcaaaaggt
gctagcgttgaattaaaagattctggtaataataatatggtactggtagttaagaaggga
gcaactactttagaattacccattaatactaacattgcaagaatgggagataaaaaggtt
gaattaagtggtgtaatagtgtacaacggcggaagaacctttgtaccgcaagatgcagtt
agcttaattaactaa

DBGET integrated database retrieval system