KEGG   Desulfotomaculum carboxydivorans: Desca_0484Help
Entry
Desca_0484        CDS       T01498                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desca_0484
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_0484
   00620 Pyruvate metabolism
    Desca_0484
   00640 Propanoate metabolism
    Desca_0484
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desca_0484
   00680 Methane metabolism
    Desca_0484
Enzymes [BR:dca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desca_0484
Lipid biosynthesis proteins [BR:dca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desca_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
505833..507773
Genome map
AA seq 646 aa AA seqDB search
MFRSNMMDFAAEEQVFYPDISFSIRANVRDTRIYDWAGIDYEGFWATEAEQLHWYRPWDK
VLDWQPPFAQWFVGGKINACYNCVDRHLSSWRRNKAAIIFEGELGDQQVLTYQDLYREVT
KFANVLRGLGVKKGDLVSIYMPMIPQAVVAMLACARIGAPHSVVFGGFSAEALRDRINDA
GAKVVVTADGCWRRGKAIPLKQNVDIALTQCPSVEKVVVVERTRSEVYMEPGRDLWYHEL
MQQAPIGCEPEVMDAEDILFILYTSGTTGKPKGIVHTTGGYLTGVTSTHRNLFDLKEDDV
YWCTADIGWITGHSYIVYGPLANGATVLLFEGAPDYPARDRFWEIIEKYRVTIFYTAPTA
IRLFMKWGEVWPNGRDLSSLRVLGSVGEPINPEAWLWYHKHIGREKCPIVDTWWQTETGM
VMVAPLPGITPTKPGSATVSLPGVAVDVVDELGNPVEAGHSGYLVIKKPWPAMLRTVYKD
PQRYVDQYWSRFPGLYFTGDGARRDKDGYIWVSGRVDDVINVSGHRIGTAEVESALVEHP
AVAEAAVIGRYHELKGQAVSAFITLREGVAWAPELEKDLKAHVAKKIGGLARPEEIICAW
ELPKTRSGKIMRRLLKDIAEGRVLGDISTLADPTVIHQLMNKKSAF
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgttccaatatgatggattttgctgccgaggagcaagtcttctatccggacata
tccttttcgatccgggccaatgtgcgggacaccagaatttatgattgggctgggatagac
tatgagggcttttgggccactgaagcggagcagctgcactggtatcggccctgggataaa
gtgttagattggcagcccccctttgcccagtggtttgtgggcggcaaaataaatgcttgc
tacaattgtgtagaccggcatctaagcagctggcgccggaataaagctgccatcattttt
gaaggggaactgggtgaccagcaggtattaacctaccaggatttgtaccgggaagttacc
aagtttgccaatgtgctgcggggcttgggggtaaaaaagggcgatctggtgagcatctat
atgcctatgattccccaggcagtggtggccatgctggcctgtgcccgcattggggcaccc
catagcgtggtatttggcggcttttctgccgaggccctgcgagatcgcattaatgacgcc
ggagctaaagtggtggttactgctgacggctgctggcggcggggcaaggccattccgtta
aaacaaaatgttgatatcgccttaacccagtgccccagtgtagaaaaggtggtagtggtg
gagcggacccgcagtgaagtctatatggagccagggcgggatctttggtatcatgaattg
atgcagcaggctcccataggctgtgagccggaggtaatggacgccgaggatattcttttc
attttatataccagcggtaccaccggtaaacccaagggtatcgtacacaccaccggcggt
tatttaaccggtgttacctccactcaccgcaacttatttgacctaaaagaagatgatgtg
tactggtgcaccgccgacatcgggtggatcaccgggcatagttatattgtttacggtccc
ctggccaacggggctacagtgctgctgtttgaaggggccccggactatccggcccgggat
cgtttttgggaaatcattgaaaaatatcgggttaccattttttataccgcacccacggcc
attcgcttatttatgaagtggggcgaggtttggcccaacggtcgggatttatcctcctta
agggtactgggttcagtgggtgaacctattaatcccgaagcctggttatggtatcacaaa
catattggcagagaaaaatgccccatcgtggatacctggtggcaaacagaaaccggtatg
gtcatggtggcccccctgccaggcataactcccaccaaaccgggctccgccaccgtgtcc
ctacccggtgtggctgtggatgtggtagatgaactggggaacccggtggaagccgggcac
agcggttacctggtcattaaaaagccatggcccgctatgttgcgtacggtttataaagac
ccccagcgttatgttgaccagtattggagccgcttcccgggcctgtattttaccggtgac
ggggcccgccgggataaggacggatatatctgggtatcaggccgggtggatgatgtaatc
aacgtatccggacacagaattggcaccgccgaagtggaaagcgcactggtggaacacccg
gcagtggcagaagcagcggttattggtcggtatcacgaattaaaagggcaggccgtttct
gctttcatcaccctgagagaaggtgtggcctgggcaccggaattggaaaaggatttaaag
gcccatgtggccaaaaagatcggtggtctggcccgaccggaagaaattatctgtgcctgg
gaactgcccaaaacccgcagcggcaaaatcatgcggcgtttgcttaaggatattgctgaa
ggaagagtgctgggggatatttccaccctggccgatcccacagtgattcaccaactaatg
aataaaaagagtgccttttaa

DBGET integrated database retrieval system