KEGG   Desulfotomaculum nigrificans: Desca_0874Help
Entry
Desca_0874        CDS       T01498                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00260  Glycine, serine and threonine metabolism
dca00750  Vitamin B6 metabolism
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01120  Microbial metabolism in diverse environments
dca01230  Biosynthesis of amino acids
Module
dca_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desca_0874
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desca_0874
Enzymes [BR:dca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desca_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Ntox44 DUF2760
Motif
Other DBs
NCBI-ProteinID: AEF93753
UniProt: F6B9H7
Position
complement(965097..966593)
Genome map
AA seq 498 aa AA seqDB search
MNYQSTRGNSPVVSAAEAIKLGIAPDGGLFVPTDKVTITYEELANLVPLSYGERATFILK
HFLTDFTEEELSQCVDAAYGGQKFDTPDVAPVRSLTGDLSVLELWHGPTCAFKDMALQML
PQFLVRAIAKTGETSHIVILVATSGDTGKAALEGFANIPGTSIIVFFPQEGVSEVQKMQM
VTQEGQNVHVVAVQGNFDDTQSGVKQVFGDVDFTGTLKEKGYRLSSANSINWGRLVPQIV
YYFSAYADLVKSGTIDLGQAINFVVPTGNFGNILAGFYAREMGLPVKRLICASNANNVLT
DFIKTGTYNRNREFFKTTSPSMDILISSNLERLLFELTGRQSDKINTWMTELKESGVYNV
DQNTLNMVQSVFWSDFATDKETLATIKKVWVQHNYLVDTHTAVAINVLEKYRQTTGDTTH
TVVASTASPFKFNSSVAGAIMGPEALAGKNEFQLLQDLSTFTGWPIPRGLRGLNRRPVLH
HKVAGKNEIDQAVRNILL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaagcacccgcggtaacagtccggttgtttctgccgctgaagcaataaaa
ctaggcattgctcccgatggtggtctttttgtacctacagataaggtgaccataacttat
gaggaacttgccaaccttgtgcccctttcctacggcgaacgggctacttttatccttaaa
catttcctgactgatttcaccgaggaggaactatcccaatgtgtagacgccgcctacggt
ggtcaaaagttcgatactccggacgtagcaccagttagatcacttaccggggatctctcc
gttttagaattatggcacgggcccacttgcgcctttaaggatatggctttacagatgctg
ccgcaatttttagtgcgagccattgctaagacaggcgagacctctcatattgtgattctg
gtggctacctccggtgataccggcaaggccgccctggagggctttgctaacataccaggc
accagcatcattgtcttctttccccaggaaggcgtcagtgaagtgcaaaagatgcaaatg
gtcacccaggaggggcaaaatgttcatgtggtagccgttcagggcaactttgacgatacc
cagagtggcgtcaagcaggtttttggtgatgtagactttaccgggacattaaaagaaaaa
ggttaccgtctctcctcagccaattccatcaactgggggcgactggtgcctcagattgtt
tactacttttcggcctacgctgacctggttaagtcgggaaccattgatttgggacaagcc
attaattttgtggtgcccaccggtaactttggcaacatcctggccggattttatgccagg
gaaatggggttgcctgtgaaacgtttgatctgtgcctctaatgctaacaacgtactaact
gatttcattaaaaccggcacttataaccgtaaccgggaatttttcaagaccacttccccc
tcaatggatatcctgatttccagtaacctggaacggttgctctttgagttgaccggccgc
caatcagataaaattaatacctggatgacggagttaaaggaaagcggcgtttataacgta
gaccaaaatacactcaacatggtgcagtcggtattctggtctgactttgccaccgataaa
gaaacattggccaccataaaaaaggtatgggtacagcataattacctggtggatactcac
accgccgtggcaattaatgtgctggaaaaataccgtcagaccaccggggacaccacccat
acagtagtggcttctaccgccagccccttcaaatttaacagcagtgtggccggagctatt
atgggcccggaagccctggcaggtaaaaatgaattccagttgttgcaagatttatcaacc
ttcaccggctggcccataccccggggacttcgtggtttaaacagacgccctgtactacat
cacaaggttgcaggtaaaaatgagattgaccaagcggtacgaaatattttgctttga

DBGET integrated database retrieval system