KEGG   Desulfotomaculum carboxydivorans: Desca_0947Help
Entry
Desca_0947        CDS       T01498                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desca_0947
Enzymes [BR:dca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Desca_0947
Exosome [BR:dca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desca_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1053119..1055017
Genome map
AA seq 632 aa AA seqDB search
MICSVPTDYDLYLFHEGSHHHSYRVFGAHPVNQDGVSGVRFSVWAPNAREVRVVGDFNRW
QGQNHVMTKDQGVWTIFVPGLSEGDIYKYEIHSPTGEVLLKADPYGFAAEARPATASRIA
CLDSYNWGDAGWQQQKKLRSSYDRPLLIYEVHLGSWRRKDGQFCSYRDLAHELVDYLVDM
GYTHVEIMPLMEHPFDGSWGYQITGYYAVTSRYGSPRDFMYFVDQCHQKGIGVILDWVPG
HFCKDAHGLRQFDGTPLYESAECLRAENSQWGTLNFDFSKPEVVSYLISNAIFWLDVYHV
DGLRVDAVAQMLYLDYGKQGGQWLPNQYGGRENLAAVDFMQRLNRAVFKYFPQALMIAEE
STQWPLVTRPTYVGGLGYNYKWNMGWMNDILRYMAMDPVHRKWAHNQLTFSFMYTFSENF
ILPLSHDEVVHGKKSLLDKMPGDYWQKFANLRALYGYMMAHPGKKLLFMGGEFGQFIEWQ
YDQSLDWHLLDYDMHRKLHRYTKDLNHFYRQQPALWEHDHDEQGFSWIDPHDYSQSVITF
MRKAKSSADFLIVVCNFTPVLRQGYRIGVPQLGSYTEVFNSDGELYGGSGQSNDTMQAGE
LPWHNQPYSLEIKLPPLATIFIKPKETTVAGS
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgatttgttcagttccaactgattatgacttatacctgttccacgagggcagtcatcac
catagctaccgggttttcggagcccatccggtaaatcaggatggtgtcagtggagtccgg
ttttccgtttgggcccccaacgctagggaagtaagggtagtgggtgattttaatcggtgg
caggggcagaaccatgtgatgacaaaggaccagggagtatggactatttttgtgcccggg
ctgtctgagggtgatatttataaatacgaaattcattcgcccaccggtgaggttttgtta
aaggcagatccctacggatttgcagcagaggctagaccggccaccgcctcccgaattgcc
tgtctggatagttataactggggggacgctgggtggcaacagcaaaaaaaactgagatcc
agctatgaccggcccctgttaatttatgaagtacacctggggtcctggcgccgaaaggat
ggacaattttgctcctaccgtgacctggcccatgaattagttgattatctggttgatatg
ggctatacccatgtggaaatcatgcctttaatggagcacccatttgacgggtcctggggt
taccagatcaccggttattatgcagttaccagccgctacggctcaccccgggactttatg
tattttgtagatcaatgtcaccaaaagggcattggcgtcattttagattgggtaccggga
catttttgtaaagatgcccatggtttaaggcaatttgacggtactcctttgtatgaatcg
gctgaatgtttacgggctgaaaatagtcaatggggaaccttaaattttgattttagtaaa
cctgaagtagtcagctatttaatttccaatgctattttttggctggatgtatatcacgtt
gatggcctccgggttgatgccgtggcccagatgctttatttggattatggcaagcaaggg
ggtcagtggttgcctaatcagtatggcgggagggaaaatctggccgctgtggattttatg
cagaggcttaaccgggcagtatttaaatattttccccaggccctgatgattgctgaggaa
tcaacccagtggccactggtgaccagacccacctacgtgggtgggcttggttacaactat
aagtggaatatgggttggatgaatgatattttacgctatatggccatggacccggtgcac
cgcaaatgggcgcataatcaactaaccttttcttttatgtataccttttcggaaaatttc
attttgcccctatcccatgatgaggtggtacacgggaagaaatccttactggataaaatg
cccggggactactggcaaaaatttgccaacctaagggctctttacgggtatatgatggct
cacccgggcaaaaaattgttgtttatgggtggggagtttggccaatttattgagtggcaa
tacgaccaaagtctggactggcatttgctggactatgatatgcatcgaaaacttcaccgt
tataccaaagatcttaaccatttttaccggcagcaacccgctttatgggaacatgatcat
gatgagcagggattcagctggattgatccccatgactacagtcaaagcgtgattacattt
atgcggaaagccaaaagttccgcagattttttgattgtggtttgtaattttacaccggtg
ctgcggcagggataccgcatcggtgtaccacagttagggtcatatacagaagtgtttaat
agcgatggagagttatacggaggatccgggcagagcaatgacaccatgcaggctggcgaa
ctgccctggcacaatcaaccctatagtctggaaattaaactacctccgttagctaccatc
tttatcaaaccaaaggagaccactgtggccggttcatga

DBGET integrated database retrieval system