KEGG   Desulfotomaculum carboxydivorans: Desca_0952Help
Entry
Desca_0952        CDS       T01498                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desca_0952
Enzymes [BR:dca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Desca_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1060796..1062286
Genome map
AA seq 496 aa AA seqDB search
MRSNRTCGILLHPTSLPSRYGIGDLGQEAYDFVDFLHRSKQKMWQILPLNPPGYGQSPFQ
CFSAFAGNPLLISLDKLVEAGLLTHQDAAHTPVFSEEKVQFDPVAEYKYSLLRKAFGNFQ
TRPQSEAYIKFVQNTPWLKDYALFMSLKDYFGGVAWNHWDKAIALREKQALRRFENLLRE
EIAYYQFLQFIFFQQWQDLKAYANNKGIKIIGDLPIFISYDSSDAWANPRLFELDELGNP
AKVAGVPPDYFSETGQLWGNPHYRWREMEKDDFKWWRERFKNLLAIVDVVRIDHFRGFEA
YWEIPAGEETAINGRWVKGPGEKLFRSIQRHLGDIPVIAEDLGVITPEVEELKNKFNFPG
MKILQFNLHPWEKEEFLPHNYEHHAVVYTGTHDNDTTLGWYQKITDPKHLKFLQEYLKLD
KDHSEQDICWRMIELAYRTRTNTVIIPLQDVLCLGSEARMNFPGTVDGNWQWRFKKGSLT
PAIAERLSRLAVSCHR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagatctaacaggacttgcggcattcttttacatcccacatcacttccatcaagatac
ggtataggcgatctgggtcaggaggcttatgattttgtagattttttacatcggagtaaa
caaaaaatgtggcaaatactgccgctgaacccgccgggttacggccaatcgccctttcaa
tgtttttccgcttttgccgggaatcctttactgataagccttgacaaactggtggaggca
gggttgttaacccaccaggatgcagcccatacccctgttttttctgaggagaaggttcaa
tttgacccggtggcagagtataaatatagtttgctgagaaaggcttttggcaattttcaa
accagaccccaaagtgaagcctacatcaaatttgtgcaaaataccccctggttaaaagac
tacgccttgtttatgtctctgaaagattattttggcggtgtggcctggaaccactgggat
aaagccatcgccctgcgggaaaaacaggccctgcggcggtttgaaaatttgctgcgggaa
gaaattgcctattaccaatttctccagtttatctttttccaacagtggcaggacctgaaa
gcctatgccaacaataaaggcatcaaaattattggtgatttacctatctttatttcatat
gacagtagcgatgcctgggccaatcctcgtctatttgaattggatgagttaggtaacccc
gccaaagtggctggagtaccaccggattatttcagcgagaccggccaactatggggtaat
ccccattaccgatggcgtgagatggagaaggacgattttaaatggtggcgggaaaggttc
aaaaatttgctggccattgttgatgtggtgcgcattgatcacttccggggctttgaggcc
tactgggagataccggcgggagaagaaaccgccatcaacggccggtgggtaaaaggaccc
ggggaaaaattattccgttccattcagcggcacttgggagatattccggtgattgccgaa
gacctgggagttatcacccccgaggtagaggaactaaaaaataaatttaactttccaggt
atgaaaatactgcaattcaacctccatccttgggaaaaggaggagtttttgccccataat
tatgagcaccatgccgtagtttataccggcacccacgataatgacaccaccctgggttgg
tatcaaaaaattactgatcccaagcacctcaagtttctgcaggaatacctgaaattggat
aaagaccactcggaacaggatatttgctggaggatgatcgagttagcataccggaccagg
accaacaccgtgattatcccgctgcaggatgtgttatgtttaggcagtgaggccaggatg
aattttcccggcaccgtggatggaaactggcagtggagatttaaaaagggcagcctaacc
ccggccattgccgaaagactaagccggttagcggtatcctgccaccgctaa

DBGET integrated database retrieval system