KEGG   Desulfotomaculum nigrificans: Desca_1025Help
Entry
Desca_1025        CDS       T01498                                 

Definition
(GenBank) Formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dca00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Desca_1025
Enzymes [BR:dca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Desca_1025
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Desca_1025
DNA repair and recombination proteins [BR:dca03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Desca_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS zinc-ribbons_6 FbpA Ribosomal_S13 Zn_ribbon_SprT eIF-5_eIF-2B Zn_Tnp_IS1595 Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: AEF93896
UniProt: F6B2R7
Position
complement(1144592..1145425)
Genome map
AA seq 277 aa AA seqDB search
MPELPEVETVVRSLEKHLAGLTITAVDVFMPKVIRSPKPEVFAERIVGKQLQKKLGRRGK
YLLLHLSDGLTLVVHLRMTGRLVYCDAEAPVEKHTHVIFHLDNGKQLRFTDQRQFGRMQL
VPTSEVNELSGIKDLGPEPLDESFTRDFLKKEIRRRRTRIKPLLLDQCFIAGLGNIYADE
ALFRARVHPERIASDLSPREIARLHKAIVEVIAGGIKHRGTTFRDYVDGEGRAGSYQQHL
KVYNRENLPCPHCGKPIARIKVAGRSSYYCPCCQKLK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagctgccggaagtagaaacagtggttcgctctctggaaaaacacctggccgga
cttaccattacggccgttgatgtatttatgcccaaagttattcgttctcctaaaccggaa
gtctttgctgaacgaattgtcggtaagcaactgcagaaaaagctaggccgccgtggtaaa
tacctgctgctgcatttaagtgacgggttaacgttggtagttcacctccgtatgaccggc
cgcctggtatactgtgatgctgaagccccggtggagaagcatacccacgtaatatttcac
ctggataacggcaaacaattaaggtttaccgaccaacgtcaatttggtaggatgcagttg
gtgcccacttcggaagttaacgaactatccgggattaaagatctggggccggaacccctg
gatgaaagctttaccagggattttttaaagaaggaaatccgccgtcggcgcactcggatt
aaacccctgttactggatcagtgttttattgccggtttgggtaatatatatgcagatgaa
gccctgttccgggcccgggtacatccggaacgaatagcctcagacttatccccccgggaa
atagccagactacataaagccattgtggaagttattgccggtggcatcaaacaccggggt
accacctttcgagattatgtggatggtgaagggcgggctggcagttatcaacaacactta
aaagtatataaccgggaaaacctgccctgccctcattgcggtaaaccgattgcccggatt
aaagtggcgggccgcagttcctattactgcccctgctgtcaaaaactgaaataa

DBGET integrated database retrieval system