KEGG   Desulfotomaculum carboxydivorans: Desca_1095Help
Entry
Desca_1095        CDS       T01498                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dca00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1217065..1217724
Genome map
AA seq 219 aa AA seqDB search
MKLAVERAKDKVARLSKKLIEYGLVAGTWGNLSTLVPEENVVVITPSGMDYNCIQSADMV
VLNLAGEVMDGERRPSSEAPLHLSIYRARQDVAGIVHTHSEVASAFAVARKPIQPVVEDA
AMLVGGPVEVAAYALPGTAELAQNVVTALGQRNAVLMANHGLVGVGRSIEEAFTICQVVE
KCARIYAWANTLGKPVILPEGDVAKLYRAYRESYGQPKK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattagctgtggagcgggccaaagataaggtagctcggttgagtaaaaaactaatc
gagtacgggttagtggctggcacctggggtaacctctccaccttggtgccggaagaaaat
gtagtggttattacacccagcgggatggattataactgcatccaatcagcagacatggtg
gttttaaacttggccggagaggttatggacggcgaacgcagaccctccagcgaagcacct
ttacatttatccatttacagggccagacaggatgtggccgggattgtgcatacccatagt
gaagtggccagcgcctttgccgtggccagaaagcccatccagccggtggtggaagatgcg
gccatgctggtgggtggaccagtggaagtggcggcctatgcattaccgggtaccgcagag
ttggcccaaaatgtggtaactgctttaggtcagcgcaatgctgtgttaatggccaatcat
ggtttggtgggggtaggcagaagcatagaagaggcctttaccatttgccaggtggtagaa
aagtgcgctcgtatttatgcctgggctaacacgttaggtaaaccggtgatattaccggaa
ggcgatgtagccaagttataccgggcttaccgtgagtcatatggtcagcccaaaaaataa

DBGET integrated database retrieval system