KEGG   Desulfotomaculum nigrificans: Desca_1319Help
Entry
Desca_1319        CDS       T01498                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00030  Pentose phosphate pathway
dca01100  Metabolic pathways
dca01120  Microbial metabolism in diverse environments
dca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desca_1319
Enzymes [BR:dca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desca_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AEF94178
UniProt: F6B4R6
Position
1443483..1445330
Genome map
AA seq 615 aa AA seqDB search
MYGYGGNILRINLSTGEIKKQPLDEVMAREWVGQRGFIAKILWDELKPGIDPLGPENKLI
MSTGPLAGTLVPAGGKVSFGAKSPATGIYGESCVGGHIAAEMKYAGYDVIILEGQASRPS
YIYINDDQVEIKDAAHLWGKGAIQTEKALKDELGEEFQICTIGPAGEKLVKYACISHDFG
RQAGRTGMGTVMGSKNIKAIAIYGSKSIPLADLPATVAKAKEMLQGCFAKENLNEWQDYG
TAGVPCWANSIGAFPTRNFQSSYLEGNETLDGKLMRQKMLVTDKGCFGCPSPCGKYCYVP
GYDVYVEGPEYETTALIGGSCVFTDIEKVGYLNYLCDELGLDTISAGNVIGFAMECYEKG
VITKEQVGREIKFGDVESFKFLVEQIVARQGIGHILAEGVKYAAEQFGGDSIKYAIQVKG
LEWSGYESRSAPSNMLAYMTCDLGAHHSRAWSVTHDIAVGRKVLEGKAKKVVDLQHIRPF
FDLIGCCRLQWVEIGFELEHYPEVCRLVTGFDYSQEELMQISEKVWNLTRAFAWREIADF
GRQYDYPPARFYEEAVTTGPNAGDFIPKEHLDKLLDDYYQLRGWDKNGLPTKEKLNSLGL
QFVVEELLKQGRKLS
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtacggttacggtggtaacatactaagaattaacctgtcaaccggggaaatcaaaaaa
caaccccttgatgaagttatggccagagagtgggttggtcaacggggattcatcgccaaa
attctttgggatgaattaaagcctggtattgatcccctgggtcctgagaataagctaatt
atgtccaccggacccctggccggaactctggtgccagcgggcgggaaagtaagttttggg
gccaaatcaccggccactggtatttacggggaaagctgtgtgggcggtcatattgccgcc
gaaatgaaatatgccggctatgatgtgattatcctggaaggccaggccagtaggcccagt
tatatttatatcaatgatgaccaggtggaaataaaggatgccgcacacctgtggggtaaa
ggcgctatccaaaccgaaaaagccctgaaggatgaattgggtgaagaattccaaatctgt
accataggccccgccggcgagaaattagttaaatacgcttgtatttcccatgattttggt
cggcaggcgggccgtaccggtatgggtactgtgatgggtagcaaaaatattaaggccatt
gccatttatggttctaaaagcattcctctggccgatctaccagccacggtggccaaggcc
aaggaaatgttacaggggtgctttgccaaggaaaacttgaacgagtggcaggattacggt
actgccggggtgccctgttgggccaattccatcggcgccttccccacccgtaacttccaa
tcctcctacctagaaggcaacgaaaccctggatggtaagttaatgcggcaaaaaatgctg
gtgactgataagggatgttttggttgccccagcccctgtggtaaatactgttatgtaccg
ggttacgatgtgtatgtggaaggaccggagtatgaaacaaccgcattaattggtggcagc
tgtgtattcaccgacatagaaaaggtagggtatttaaactacctatgtgatgaattaggt
ttagacaccatttctgcgggtaacgttattggtttcgccatggagtgctatgaaaagggt
gttatcaccaaagaacaggttggccgggaaattaaatttggcgatgtggagtccttcaaa
tttttagtggagcaaattgtggctagacaaggaattggccacatactggccgaaggagtt
aaatatgcagcggagcagtttggcggtgattccattaaatacgctatccaagtcaagggc
ctggaatggagcggctatgagtcccgcagtgcaccgtccaacatgctggcttatatgacc
tgtgatttaggtgcccaccatagccgggcctggtctgttacccacgatatcgctgtgggc
agaaaagtgctggagggtaaggccaaaaaggtggttgatttgcagcatattagacctttc
tttgatctcataggttgctgccgcttacagtgggtggaaattggttttgaactagaacat
tacccggaggtatgccgcttagttaccggctttgactacagccaggaagagttaatgcaa
atttccgagaaggtttggaatctaaccagggcctttgcctggcgtgaaatagctgacttt
ggccgtcagtacgactacccgccggctcgcttctacgaagaagccgtaaccaccggtccc
aatgccggagatttcattcctaaagaacatctggataaactactggacgattattatcaa
ctacgtggctgggacaaaaatggcctgcctaccaaagaaaaactaaattctttaggtttg
caatttgtagtggaggaattgctcaaacaggggagaaagttatcttaa

DBGET integrated database retrieval system