KEGG   Desulfotomaculum carboxydivorans: Desca_1331Help
Entry
Desca_1331        CDS       T01498                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desca_1331
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desca_1331
   00640 Propanoate metabolism
    Desca_1331
   00660 C5-Branched dibasic acid metabolism
    Desca_1331
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desca_1331
Enzymes [BR:dca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desca_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1456191..1457330
Genome map
AA seq 379 aa AA seqDB search
MKLYEYMGKDIFRKEGIPVPRGQAFFNPTGVAEYAAGLPAVVVKSQVLSGGRSKAGGIKF
PATATDAAAAAEALLGTVIKDLSVQAVLVEEKLTIDKEYYVAITVDGARRKPLVIASAYG
GVDIEEVPEHQLVKMHVDVHSGIQPYLGREVARRMGLPAGEAKQFADILVKMYTIFRKYD
AELVEINPLVVSGDKLVAADAKFNIDDEASFRWPDWLPRVEERSQLELRATELGISFVEL
DGDIAVMANGAGITMATPDMLNHFGGSPRNFMDAGGGASTEATAKALEILLSTNPRAILI
NIFGGITRCDDVARAFAHVRETTGIPVPIVIRLVGTNEQAGIEVLQQQGMSAYRNIDEAV
VKVVELAAGKGDLYSGDNH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtacgagtatatggggaaggatatctttcgtaaagaaggtattccggtaccc
cggggccaggctttttttaatccgacgggggtggctgagtatgccgccgggctgccagcc
gtggtagtgaagagccaggtattatctggcggcaggagcaaagccgggggtataaagttt
cccgctactgccaccgatgccgcagcggcggcggaagcattgctgggtacggtaattaaa
gatctatcggtgcaagcggtgctggtggaagaaaagttaactattgataaggagtattat
gtggccattaccgtggatggggcccggcgtaagcccctggtcattgcctcagcctatggt
ggagtggatatagaagaagttccggagcaccagctagttaaaatgcatgtggatgtgcat
agcggtatccaaccctatctgggacgggaagtggcccgccgcatgggtttgcctgccggt
gaggccaagcaatttgctgacatactggttaaaatgtacaccatattccgtaagtacgac
gcggagttagtggagattaacccgctggtggttagtggcgataaactggtggcagctgat
gctaagtttaacattgacgatgaagcatctttccgttggcctgattggctgccccgggtg
gaggaacgcagccaactggaattaagggctaccgagctgggtatttcctttgtggagcta
gacggagatattgctgtgatggccaacggggccggtattactatggctactccggatatg
ctgaaccattttgggggtagccccaggaactttatggatgccgggggtggggccagtacc
gaagccaccgctaaggccctggaaatattactttccactaatcctagagccattttaata
aatatttttggtggtattaccagatgtgatgatgtggcccgggcctttgcccatgtgagg
gaaaccaccggtatcccggtacccattgtcatccggttggtgggtaccaatgagcaggcc
gggatagaagttcttcagcagcagggcatgagtgcctatcgtaacattgatgaagccgtg
gtgaaagtggtggaactggcggcgggtaagggggatctttatagtggcgataatcattga

DBGET integrated database retrieval system