KEGG   Desulfotomaculum nigrificans: Desca_1331Help
Entry
Desca_1331        CDS       T01498                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00020  Citrate cycle (TCA cycle)
dca00640  Propanoate metabolism
dca00660  C5-Branched dibasic acid metabolism
dca00720  Carbon fixation pathways in prokaryotes
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01120  Microbial metabolism in diverse environments
dca01130  Biosynthesis of antibiotics
dca01200  Carbon metabolism
Module
dca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desca_1331
   00640 Propanoate metabolism
    Desca_1331
   00660 C5-Branched dibasic acid metabolism
    Desca_1331
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desca_1331
Enzymes [BR:dca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desca_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA GARS_A ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEF94190
UniProt: F6B4S8
Position
1456191..1457330
Genome map
AA seq 379 aa AA seqDB search
MKLYEYMGKDIFRKEGIPVPRGQAFFNPTGVAEYAAGLPAVVVKSQVLSGGRSKAGGIKF
PATATDAAAAAEALLGTVIKDLSVQAVLVEEKLTIDKEYYVAITVDGARRKPLVIASAYG
GVDIEEVPEHQLVKMHVDVHSGIQPYLGREVARRMGLPAGEAKQFADILVKMYTIFRKYD
AELVEINPLVVSGDKLVAADAKFNIDDEASFRWPDWLPRVEERSQLELRATELGISFVEL
DGDIAVMANGAGITMATPDMLNHFGGSPRNFMDAGGGASTEATAKALEILLSTNPRAILI
NIFGGITRCDDVARAFAHVRETTGIPVPIVIRLVGTNEQAGIEVLQQQGMSAYRNIDEAV
VKVVELAAGKGDLYSGDNH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtacgagtatatggggaaggatatctttcgtaaagaaggtattccggtaccc
cggggccaggctttttttaatccgacgggggtggctgagtatgccgccgggctgccagcc
gtggtagtgaagagccaggtattatctggcggcaggagcaaagccgggggtataaagttt
cccgctactgccaccgatgccgcagcggcggcggaagcattgctgggtacggtaattaaa
gatctatcggtgcaagcggtgctggtggaagaaaagttaactattgataaggagtattat
gtggccattaccgtggatggggcccggcgtaagcccctggtcattgcctcagcctatggt
ggagtggatatagaagaagttccggagcaccagctagttaaaatgcatgtggatgtgcat
agcggtatccaaccctatctgggacgggaagtggcccgccgcatgggtttgcctgccggt
gaggccaagcaatttgctgacatactggttaaaatgtacaccatattccgtaagtacgac
gcggagttagtggagattaacccgctggtggttagtggcgataaactggtggcagctgat
gctaagtttaacattgacgatgaagcatctttccgttggcctgattggctgccccgggtg
gaggaacgcagccaactggaattaagggctaccgagctgggtatttcctttgtggagcta
gacggagatattgctgtgatggccaacggggccggtattactatggctactccggatatg
ctgaaccattttgggggtagccccaggaactttatggatgccgggggtggggccagtacc
gaagccaccgctaaggccctggaaatattactttccactaatcctagagccattttaata
aatatttttggtggtattaccagatgtgatgatgtggcccgggcctttgcccatgtgagg
gaaaccaccggtatcccggtacccattgtcatccggttggtgggtaccaatgagcaggcc
gggatagaagttcttcagcagcagggcatgagtgcctatcgtaacattgatgaagccgtg
gtgaaagtggtggaactggcggcgggtaagggggatctttatagtggcgataatcattga

DBGET integrated database retrieval system