KEGG   Desulfotomaculum carboxydivorans: Desca_1349Help
Entry
Desca_1349        CDS       T01498                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1472233..1472796
Genome map
AA seq 187 aa AA seqDB search
MFDLHKIEQAVKMILEAIGEDPQREGLLETPARVAKMYQEIFMGLEEDPSEHLSKTFSEE
HEEMVLVKDIPLFSMCEHHLIPFIGKAHVCYIPRNGNVTGLSKLARLVNGYARRPQLQER
LTKQIADAIMTKLNPYGVVVVVEAEHLCMSMRGVRVPGAHTVTSAVRGLFKKNDASRAEA
MSLILKS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatttacataaaatagagcaagcagtaaaaatgattttagaagctattggcgaa
gatccccagcgggaggggttattagagacccctgctcgggttgctaagatgtatcaggag
atatttatgggattggaagaagatccctcagaacatctgagcaagaccttttctgaagag
catgaggaaatggtgctggtaaaagatatccctttatttagcatgtgtgaacaccattta
atacctttcatagggaaagcccacgtctgttatattcccagaaatggcaatgtaaccggc
ctttctaaattggccaggttagtaaacggttatgcccgccggccccaattgcaagaacga
ttgacaaaacaaattgccgatgccattatgaccaaattaaacccttacggcgtggtggtc
gtggtagaggcagagcatctatgtatgtccatgcgtggggtcagggtaccgggtgcccat
acagttacctcagcggtacgggggctgtttaagaagaatgatgcctcccgggccgaagcc
atgagtttgattcttaaatcttaa

DBGET integrated database retrieval system