KEGG   Desulfotomaculum carboxydivorans: Desca_1361Help
Entry
Desca_1361        CDS       T01498                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desca_1361
   01230 Biosynthesis of amino acids
    Desca_1361
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_1361
   00030 Pentose phosphate pathway
    Desca_1361
   00051 Fructose and mannose metabolism
    Desca_1361
   00052 Galactose metabolism
    Desca_1361
  Energy metabolism
   00680 Methane metabolism
    Desca_1361
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desca_1361
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desca_1361
Protein phosphatases and associated proteins [BR:dca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desca_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1485550..1486635
Genome map
AA seq 361 aa AA seqDB search
MIFLIKKVAVLTGGGDAPGLNAVIRAIVKTAVREYGIEVIGFRDGFKGVMEHKLLPLTED
AVSGILPRGGTILGTTNRDNPFHYQVAPGEFADRSDECIEIIRKNADALIVIGGDGSLSI
AHDLSQKGLPVVGCPKTIDNDLAVGQAKTFGFDTAYAFATEALDRLHATAESHHRVIVLE
VMGRYAGHIALHAGIAGGADVILIPEIPFRYEQIVAKIQDRLNKNKRFSLVVAAEGAKPA
GGNMVVQKVVAESTDPIRLGGIGNVVAQELEQRTGIEARVTVLGHLQRGGSPTPYDRILA
TRYGVAAIDLVMQGKFGYVVSLEGEKTVPIALSEIAKGIRKVDAAGELVKAARKIGISFG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgatctttttgataaagaaagtagcggtattgacgggtggtggagatgcccccggctta
aacgcagtgatcagggctattgttaagactgctgttagagaatatgggattgaggttatt
ggtttccgggatggttttaaaggagtaatggaacacaaactcctgccattaaccgaagat
gctgtatccggtatattaccaaggggaggaactattttaggcaccaccaaccgggataat
ccttttcactaccaggtggcacctggtgaatttgccgaccgctcggatgaatgcatcgag
ataatacgtaaaaatgctgatgccttaattgtcatcgggggagacggcagtctatccatc
gcccatgatttgtcccaaaagggattaccggtagtgggatgtccaaagaccattgataat
gacctggcggtagggcaggccaagacctttggttttgacaccgcctacgcctttgccacc
gaagcactggaccgcctgcatgccacggcggagtcacatcatagagtgattgtactagaa
gtaatgggccgctatgccgggcacatagccttacatgcgggtatcgccggaggggcagac
gtcattttaattccggaaataccctttagatatgagcagattgtagccaagattcaggat
cgtctgaacaagaataaacgctttagtctggtagtggccgccgaaggggctaaacctgcc
ggtggaaacatggtagttcaaaaggtggtggcagaaagtactgaccccatccgtttaggt
ggtattggtaatgtagtggcccaggaattagaacaaagaaccggcatagaagcaagggtt
acggtactggggcacctacaaaggggtggtagtcccaccccttacgacaggattttagct
acccgttatggggtggctgccatagatctggtgatgcaaggaaagttcggttatgttgta
tcactggaaggggaaaaaactgtaccaattgccctttctgagatagccaaaggaatcaga
aaagtggatgcggccggtgaactggttaaggctgccagaaagataggcatatcctttggt
gattaa

DBGET integrated database retrieval system