KEGG   Desulfotomaculum nigrificans: Desca_1686Help
Entry
Desca_1686        CDS       T01498                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dca  Desulfotomaculum nigrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desca_1686
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desca_1686
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desca_1686
Enzymes [BR:dca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desca_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1810029..1811219)
Genome map
AA seq 396 aa AA seqDB search
MQPDIRGYFGKYGGTFVPETLMPALEELIKAYDEARQDPDFQREVDYYLTNYVGRPSPVY
LARALSARLGGAKIYLKREDLNHTGAHKINNTVGQVILARRMGKKRIIAETGAGQHGVAT
ATAAAMFGLKCVVYMGAEDIQRQALNVFRMRLLGTEVVEVSSGSGTLKDAMNEAMRDWVT
NVRDTYYVIGSVAGPHPYPMMVRDFQAVIGREARQQMLEQTGALPDCVIACVGGGSNAMG
TFYAFLDDPEVKLVGVEAGGKGLSSGQHAATLTAGRPGVLHGSYSYLMQDSHGQVAPVHS
VSAGLDYPGVGPEHSHLKDIGRVQYTVATDEEALSAFHLLCRTEGIIPALESSHALAEAI
KVAPQMAGHQSILVCLSGRGDKDVHTVAREMGVELV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggatattagaggatattttggaaagtacggaggaacctttgtgccggagaca
ttaatgccggccctggaggaactgattaaggcatatgatgaagcccggcaggacccggat
tttcaaagagaagtggactattacttaactaactatgtagggcgaccctcaccggtatac
ctggcccgggccctgagtgccaggttggggggggctaagatttatttaaaacgggaggat
ttaaaccacaccggtgcacacaagattaacaacacagtgggtcaggtaatattggcccgg
cgcatgggtaagaaaagaattattgctgaaaccggcgccggccagcatggggtagccaca
gccactgcggcagccatgtttggcttaaaatgtgttgtttacatgggagcggaagatatt
cagcgccaggcccttaatgttttccgcatgcgcttactgggaacagaagtggtagaggtt
tcttccggcagcggcaccttaaaagatgccatgaatgaagccatgcgagattgggtaacc
aatgtacgtgatacctactacgttatcgggtcagtggccggacctcacccctatcccatg
atggtaagggactttcaggctgtgatcggccgggaagcccgccagcaaatgctggaacaa
accggcgctttgccggattgtgttattgcctgtgtgggcggcggcagtaatgccatggga
accttttacgcctttctggatgatcctgaagtaaagctggtgggtgtggaagcgggaggt
aaagggctaagctccggtcaacatgctgccaccctaactgccggcagaccgggggtactg
cacggctcctacagttatctaatgcaggacagccatggccaggtggcaccggttcactca
gtttccgccggactggattaccccggagtaggtccggagcatagtcacttgaaagatatt
ggccgggtccaatatacggtggccaccgacgaggaagccctgtccgcctttcacctgctt
tgccgcaccgagggcatcatcccggccttggaaagttcccatgccctggcggaagccatc
aaagtagcgccacaaatggccggccaccagtccatcctggtttgtttgtccggccgggga
gataaagatgtccacacggtggccagagaaatgggggttgaactggtatga

DBGET integrated database retrieval system