KEGG   Desulfotomaculum nigrificans: Desca_1686Help
Entry
Desca_1686        CDS       T01498                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00260  Glycine, serine and threonine metabolism
dca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01130  Biosynthesis of antibiotics
dca01230  Biosynthesis of amino acids
Module
dca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desca_1686
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desca_1686
Enzymes [BR:dca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desca_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEF94534
UniProt: F6B7I0
Position
complement(1810029..1811219)
Genome map
AA seq 396 aa AA seqDB search
MQPDIRGYFGKYGGTFVPETLMPALEELIKAYDEARQDPDFQREVDYYLTNYVGRPSPVY
LARALSARLGGAKIYLKREDLNHTGAHKINNTVGQVILARRMGKKRIIAETGAGQHGVAT
ATAAAMFGLKCVVYMGAEDIQRQALNVFRMRLLGTEVVEVSSGSGTLKDAMNEAMRDWVT
NVRDTYYVIGSVAGPHPYPMMVRDFQAVIGREARQQMLEQTGALPDCVIACVGGGSNAMG
TFYAFLDDPEVKLVGVEAGGKGLSSGQHAATLTAGRPGVLHGSYSYLMQDSHGQVAPVHS
VSAGLDYPGVGPEHSHLKDIGRVQYTVATDEEALSAFHLLCRTEGIIPALESSHALAEAI
KVAPQMAGHQSILVCLSGRGDKDVHTVAREMGVELV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggatattagaggatattttggaaagtacggaggaacctttgtgccggagaca
ttaatgccggccctggaggaactgattaaggcatatgatgaagcccggcaggacccggat
tttcaaagagaagtggactattacttaactaactatgtagggcgaccctcaccggtatac
ctggcccgggccctgagtgccaggttggggggggctaagatttatttaaaacgggaggat
ttaaaccacaccggtgcacacaagattaacaacacagtgggtcaggtaatattggcccgg
cgcatgggtaagaaaagaattattgctgaaaccggcgccggccagcatggggtagccaca
gccactgcggcagccatgtttggcttaaaatgtgttgtttacatgggagcggaagatatt
cagcgccaggcccttaatgttttccgcatgcgcttactgggaacagaagtggtagaggtt
tcttccggcagcggcaccttaaaagatgccatgaatgaagccatgcgagattgggtaacc
aatgtacgtgatacctactacgttatcgggtcagtggccggacctcacccctatcccatg
atggtaagggactttcaggctgtgatcggccgggaagcccgccagcaaatgctggaacaa
accggcgctttgccggattgtgttattgcctgtgtgggcggcggcagtaatgccatggga
accttttacgcctttctggatgatcctgaagtaaagctggtgggtgtggaagcgggaggt
aaagggctaagctccggtcaacatgctgccaccctaactgccggcagaccgggggtactg
cacggctcctacagttatctaatgcaggacagccatggccaggtggcaccggttcactca
gtttccgccggactggattaccccggagtaggtccggagcatagtcacttgaaagatatt
ggccgggtccaatatacggtggccaccgacgaggaagccctgtccgcctttcacctgctt
tgccgcaccgagggcatcatcccggccttggaaagttcccatgccctggcggaagccatc
aaagtagcgccacaaatggccggccaccagtccatcctggtttgtttgtccggccgggga
gataaagatgtccacacggtggccagagaaatgggggttgaactggtatga

DBGET integrated database retrieval system