KEGG   Desulfotomaculum carboxydivorans: Desca_1697Help
Entry
Desca_1697        CDS       T01498                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desca_1697
   01230 Biosynthesis of amino acids
    Desca_1697
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_1697
   00030 Pentose phosphate pathway
    Desca_1697
   00051 Fructose and mannose metabolism
    Desca_1697
   00052 Galactose metabolism
    Desca_1697
  Energy metabolism
   00680 Methane metabolism
    Desca_1697
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desca_1697
Protein phosphatases and associated proteins [BR:dca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desca_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1820395..1821357)
Genome map
AA seq 320 aa AA seqDB search
MQRIGVLTSGGDASGMNSCIRAVVRKAIYHGIEVIGIKRGYSGFIEAEMYPMNLGSVADI
IHRGGTILHTARSERFKTKEGRALAMENVQRFGIQGLVVIGGDGSFTGASIFHQEYGIPV
ICVPGTIDNDIAGTDYTIGFDTAVNNVVDAINKIRDTATSHERTFVIEVMGRGSGNIALA
AGLAGGAESILIPEIPFNVQDICHKLLSGLKRGKLHSIILVAEGAASGLEIGKQIKELTG
LDTKVTILGHLQRGGIPTAFDRTLAARLGAKAVELLKDGETNKMVGIKSGEIVATDLTEV
IGQPKSIDKEMYELAKILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggattggtgtcttaacaagtggcggggatgcctcgggaatgaactcctgtatt
cgagcagtggtccgtaaagccatttatcacggtattgaagtcatagggattaagcgtggt
tatagtggattcattgaagcggaaatgtatccgatgaatctcggttcggtggctgacatt
atacataggggcggcacaattctccataccgcccggtcagaacgctttaagactaaggaa
ggtcgggctctggccatggaaaatgtgcagcgttttggtattcaaggtttggttgttatt
ggcggtgacggctcctttaccggtgccagtatttttcaccaggaatatggtatcccggtg
atttgtgtgcccggtaccattgataatgatattgccggcactgattataccattggtttt
gatactgccgttaacaatgtggttgatgccatcaacaaaatcagagatactgctacctcc
catgagcgcacctttgtcattgaagtgatgggccgtggatcgggtaatattgccctggcc
gccggtttagccggcggtgcggagagcatcctgattcctgaaataccttttaatgtgcaa
gatatttgccacaagctgttgagtggtttaaaaagaggtaaattacactccataatttta
gtggctgaaggtgccgccagtgggctggaaataggtaagcaaattaaggagttaaccggt
cttgataccaaggttactattctgggccatttgcaaagagggggaattcccactgccttt
gaccgtactctggcggccaggttgggagctaaggcagtggagctgttaaaagacggagaa
actaacaaaatggttggtattaagtcaggagaaattgtggccaccgatctaacggaagta
atcggccaacccaagtcaatagataaagaaatgtatgagctggctaaaatactttctatt
taa

DBGET integrated database retrieval system