KEGG   Desulfotomaculum carboxydivorans: Desca_1910Help
Entry
Desca_1910        CDS       T01498                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desca_1910
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Desca_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2026405..2027310)
Genome map
AA seq 301 aa AA seqDB search
MPKPHVLVIGSLNMDLVSYSDRIPHVGETVLGQRFATVPGGKGANQAMAAVKLGAKVTML
GAVGNDSYGDQLLSHLKQHGVDTTRVLRTGSTTGVALINVDANGNNQIVVVPGANYDLGP
AELVRRQQVFADADVVVLQLEIPLPTVGQAIELAHKYHKPVILNPAPAQPLPDDWLNQVD
YLIPNEHEALLLAGSEENFYVALRQKMKHTLIVTRGEKGVTFMHQNQLVSVPAFMVQAVD
TTAAGDAFIGGFSVALAEGLGLPEAIRFGCAVAALSVTKEGAQTSLPLRQEVEHFMGGLK
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacctcatgtattagtgatcggtagccttaacatggatttagttagttattcg
gatagaattcctcatgtgggagaaactgttttaggccaacgttttgccaccgtacccgga
ggtaagggagctaatcaggctatggcagcagtaaaattaggagctaaagttaccatgctg
ggggcggtaggtaatgatagctatggggaccaactgctaagtcacttaaaacaacatggt
gtggatacaaccagggtgctcagaacgggcagcaccaccggcgtagctttaattaacgtg
gatgccaatggtaacaaccaaattgtagtggttcccggggccaattatgacctggggcct
gctgaactggtccgccgacagcaggtctttgccgatgccgatgtggtggtactgcagctg
gaaattcctttgcccacagtaggtcaagccattgaattagcccataaataccataaacct
gtgatcttaaacccggccccggcgcaaccgctgccggatgattggctgaaccaagttgat
tatcttattcccaatgaacatgaagctttgttgctggccggcagcgaagaaaatttttac
gtcgctttgcgtcaaaagatgaagcacacactgattgttacccggggtgaaaagggagtt
acctttatgcaccaaaaccagttagtcagtgtacccgcctttatggtgcaggctgtagat
accacagccgccggggatgcttttattggcggtttcagtgtggccctggccgaaggattg
ggcctcccggaggctattagatttggttgtgccgtagcggccctgtcggtaaccaaagaa
ggagcccaaacatcactgcctttgcgacaagaagtagaacattttatgggaggtctgaaa
cagtga

DBGET integrated database retrieval system