KEGG   Desulfotomaculum carboxydivorans: Desca_1928Help
Entry
Desca_1928        CDS       T01498                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desca_1928
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desca_1928
   00650 Butanoate metabolism
    Desca_1928
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Desca_1928
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desca_1928
   00622 Xylene degradation
    Desca_1928
   00621 Dioxin degradation
    Desca_1928
Enzymes [BR:dca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desca_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2046049..2046924)
Genome map
AA seq 291 aa AA seqDB search
MEKVKVAVIGPGNIGSDLMYKIFRSKYLEMALMTGIVESEGIKRARNLGVKTSTDGVNAV
LAEEDIKIVFDATGAKPHLMHAPLLKAAGKIAIDLTPAAVGPYVVPPANLDKVQAEPNLN
MVTCGGQATVPIVYAINQVAGVNYAEIVACISSKSAGPGTRQNIDEFTQTTARALRVVGG
AKESKAIIVLNPAEPPLMMSNTIYTEVENPDEKAITEAVNAMVKEIQSYVPGYRLRVPPI
IDGNKVTTIVEVEGAGDFLPKYSGNLDIITSAAVAVAEKIAAKILSKEVVA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaagtaaaagtagcagtcatcgggcctggtaacattggctcagacctgatgtac
aagattttccgcagcaagtatttagaaatggccctgatgacaggtatcgtagaatctgag
ggcattaagcgggcacgtaacctgggggttaaaacctccaccgatggcgtaaatgctgtt
ctggcagaagaagatattaaaatcgtttttgatgccaccggtgctaaacctcatttgatg
cacgccccgctacttaaggcagcaggaaaaattgccattgacctcactccggcagcagtt
ggaccctacgtggtacctccggcaaacctggataaggtacaggcggagcctaatttaaac
atggtaacctgtggcggacaggcaacagtacctatcgtatatgctattaaccaggtagcc
ggggtaaactacgcagaaatcgttgcctgcatctccagtaagagtgccggcccgggtacc
aggcaaaatattgatgaattcacccaaacaacagccagagcattaagagtagttggcggc
gctaaagagagtaaggctattatcgtactaaaccctgcagaaccaccattgatgatgtca
aataccatttatactgaggtagagaatccggatgaaaaagccattacagaggccgtaaac
gctatggtaaaagaaattcaatcctatgttccggggtatcgcctgcgggttccccccatc
attgacggaaacaaagtaaccaccattgttgaagttgaaggtgctggggatttcctgccc
aaatactcaggcaatcttgatattattacctccgctgcagttgccgttgctgaaaaaatt
gcagcaaaaatcttaagtaaggaagtggtagcatga

DBGET integrated database retrieval system