KEGG   Desulfotomaculum carboxydivorans: Desca_2490Help
Entry
Desca_2490        CDS       T01498                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desca_2490
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desca_2490
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desca_2490
Enzymes [BR:dca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desca_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2615016..2616224)
Genome map
AA seq 402 aa AA seqDB search
MSYVTHLECAKCGKHYNSEEVHQLCECGGPLLVRYDLERVKENFRKEDLKDREPSLWRYW
ELLPLRDRKNLVSLGEGMTPIIKMEAAGPEIGLNNLYLKDEGIIPSGTFKSRGATVGVSR
AKELGIKVLAMPTNGNAGAAWATYGARAGIKSVIVMPKDAPEITRNECAIAGADLYLVDG
LISDAGKIVGRAVKKYGWFDVSTLKEPYRIEGKKTMGLEIAEQFNWEVPDVILYPTGGGV
GIIGIYKALRELQAIGWIGEKMPRLVAVQAEGCAPIVKAYNEKKTESEFWNNAHTCAFGI
TVPKALGDFLVLDAVYKTNGCAIAISDEDLLKAQATLAAKEGAFVCPEGASLYSAAQKLR
EQGWLKADEKVVMLNTGTGLKYPETVKVNVPLLQPEDDIPEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgtaacacatctggaatgcgccaaatgcggcaaacactacaacagtgaagaa
gttcatcaactgtgtgagtgtggcggccctttactggttcgctacgatttggaacgtgta
aaggaaaactttcgcaaagaagatttaaaagatcgcgaaccaagcctgtggcgttactgg
gaactgcttcccctgcgggatagaaagaacctggtttccctgggtgaaggtatgaccccc
attattaaaatggaagcagccggtccggagattggtttaaacaatctttacctgaaggac
gaaggcatcattccttccggaacctttaaatccaggggtgctacagtgggtgtatcccgg
gcgaaagagcttggtatcaaggtgctggctatgcccaccaacggtaacgccggtgctgcc
tgggccacctatggtgccagagccggtattaaatcggttattgtgatgcccaaggatgcc
ccggaaattacccgtaacgagtgtgccattgccggtgccgacctctacctggtggacggt
ttaatcagtgacgccggaaaaatcgtaggccgggctgttaaaaagtacggttggttcgat
gtttccaccttaaaagagccctaccggattgaaggtaaaaagaccatggggctggaaatt
gctgagcagtttaactgggaggttcccgatgtcatcctttatcccaccggtggcggtgta
ggtatcatcggtatttacaaagccctgcgggaactgcaagccatcgggtggatcggtgaa
aaaatgccccgcttggtagctgtccaagcagaaggatgcgcccccattgttaaggcatac
aacgagaagaaaactgagtccgaattttggaacaacgctcatacctgtgcctttggtatc
accgtacccaaagccctgggtgacttcctggtattagatgctgtttacaaaaccaatggc
tgtgctattgccatcagtgatgaagatctgttaaaagctcaggctaccctggccgctaaa
gaaggcgctttcgtttgcccggaaggtgcttccctgtacagcgcggctcagaaactgaga
gagcaaggttggctcaaggccgatgaaaaagtagttatgcttaacaccggtaccggtttg
aaatatcctgaaaccgttaaggtaaatgttcctttactgcagccggaagatgatattccg
gaagcctaa

DBGET integrated database retrieval system