KEGG   Desulfotomaculum carboxydivorans: Desca_2521Help
Entry
Desca_2521        CDS       T01498                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desca_2521
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_2521
   00052 Galactose metabolism
    Desca_2521
   00500 Starch and sucrose metabolism
    Desca_2521
   00520 Amino sugar and nucleotide sugar metabolism
    Desca_2521
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desca_2521
   00524 Butirosin and neomycin biosynthesis
    Desca_2521
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desca_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2654080..2655063)
Genome map
AA seq 327 aa AA seqDB search
MQANVVAGIDLGGTKILTAVADRQGRVLAEVRLATEAAKGTRVILQNVRRSVEQAMSKAE
LAGLPGAIGIGVPGAVQAGLVHLAPNLGWQDYHLTEDLGQLFGCPIAVANDANLAALGEY
CFGAGQGSDNMVYITVSTGVGGGIIYQGEIMAGVSGTAGEIGHITIDPQGPRCNCGGKGC
LEAIASGTAIARQARELAAQGRGQGILSHVDADGVITATAVGRAAAAADPEAREILHRAA
GALGIGLAAVANILNPSLIVIGGGVMAMREIIWPVMEAEFNARTHRGARRAVTLVNAALG
GRAGVLGALALALKEVGGVTGTTHPPV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaatgtggtggccggtattgacctgggaggcacgaaaattctcactgccgtg
gcggatcggcagggacgggttttggccgaggtgcgtctggccaccgaggcagccaaaggt
acccgggtgatactgcaaaatgtacgccggtcagtggaacaagccatgagtaaggctgaa
ctagcgggcctgcccggtgccataggcattggggtgccaggggcggtgcaggcaggcctg
gtccacctggcccctaacctgggctggcaggactaccatttaactgaggacctgggccaa
ttatttggttgtcccattgccgtggccaatgatgccaacctggccgccctgggtgagtac
tgcttcggagcgggacagggcagtgacaatatggtgtacattaccgtcagtaccggggtg
ggcggcggtatcatttatcagggtgaaatcatggccggagtttccggcaccgccggggaa
atcggccacattaccattgacccccagggcccccgctgcaactgcggcggcaaaggttgt
ttggaggccatcgcctccggcaccgccattgcccggcaggccagggaattggcggcccag
ggccggggacagggaattttatcccatgttgatgcggatggtgtcattactgccacagca
gtaggtcgggcggcggccgccgccgacccggaagccagggaaattttgcaccgggcagcc
ggtgccctgggcattggcttagccgctgtagccaatatattaaacccttctttaattgtc
attggcggcggcgtgatggccatgcgagagataatctggccggtaatggaagcggaattt
aatgcccgcacccaccggggagcccgtcgggcggtgaccctggttaatgcggccttaggc
ggccgggcgggtgttttaggcgcactggccctggctttaaaggaagtgggcggtgtgact
ggcaccactcacccaccggtttaa

DBGET integrated database retrieval system