KEGG   Desulfotomaculum nigrificans: Desca_2521Help
Entry
Desca_2521        CDS       T01498                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00010  Glycolysis / Gluconeogenesis
dca00052  Galactose metabolism
dca00500  Starch and sucrose metabolism
dca00520  Amino sugar and nucleotide sugar metabolism
dca00521  Streptomycin biosynthesis
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
dca01120  Microbial metabolism in diverse environments
dca01130  Biosynthesis of antibiotics
dca01200  Carbon metabolism
Module
dca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desca_2521
   00052 Galactose metabolism
    Desca_2521
   00500 Starch and sucrose metabolism
    Desca_2521
   00520 Amino sugar and nucleotide sugar metabolism
    Desca_2521
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desca_2521
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Desca_2521
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desca_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEF95347
UniProt: F6B4X5
Position
complement(2654080..2655063)
Genome map
AA seq 327 aa AA seqDB search
MQANVVAGIDLGGTKILTAVADRQGRVLAEVRLATEAAKGTRVILQNVRRSVEQAMSKAE
LAGLPGAIGIGVPGAVQAGLVHLAPNLGWQDYHLTEDLGQLFGCPIAVANDANLAALGEY
CFGAGQGSDNMVYITVSTGVGGGIIYQGEIMAGVSGTAGEIGHITIDPQGPRCNCGGKGC
LEAIASGTAIARQARELAAQGRGQGILSHVDADGVITATAVGRAAAAADPEAREILHRAA
GALGIGLAAVANILNPSLIVIGGGVMAMREIIWPVMEAEFNARTHRGARRAVTLVNAALG
GRAGVLGALALALKEVGGVTGTTHPPV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaatgtggtggccggtattgacctgggaggcacgaaaattctcactgccgtg
gcggatcggcagggacgggttttggccgaggtgcgtctggccaccgaggcagccaaaggt
acccgggtgatactgcaaaatgtacgccggtcagtggaacaagccatgagtaaggctgaa
ctagcgggcctgcccggtgccataggcattggggtgccaggggcggtgcaggcaggcctg
gtccacctggcccctaacctgggctggcaggactaccatttaactgaggacctgggccaa
ttatttggttgtcccattgccgtggccaatgatgccaacctggccgccctgggtgagtac
tgcttcggagcgggacagggcagtgacaatatggtgtacattaccgtcagtaccggggtg
ggcggcggtatcatttatcagggtgaaatcatggccggagtttccggcaccgccggggaa
atcggccacattaccattgacccccagggcccccgctgcaactgcggcggcaaaggttgt
ttggaggccatcgcctccggcaccgccattgcccggcaggccagggaattggcggcccag
ggccggggacagggaattttatcccatgttgatgcggatggtgtcattactgccacagca
gtaggtcgggcggcggccgccgccgacccggaagccagggaaattttgcaccgggcagcc
ggtgccctgggcattggcttagccgctgtagccaatatattaaacccttctttaattgtc
attggcggcggcgtgatggccatgcgagagataatctggccggtaatggaagcggaattt
aatgcccgcacccaccggggagcccgtcgggcggtgaccctggttaatgcggccttaggc
ggccgggcgggtgttttaggcgcactggccctggctttaaaggaagtgggcggtgtgact
ggcaccactcacccaccggtttaa

DBGET integrated database retrieval system