KEGG   Desulfotomaculum nigrificans: Desca_2575Help
Entry
Desca_2575        CDS       T01498                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00040  Pentose and glucuronate interconversions
dca00052  Galactose metabolism
dca00500  Starch and sucrose metabolism
dca00520  Amino sugar and nucleotide sugar metabolism
dca01100  Metabolic pathways
dca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desca_2575
   00052 Galactose metabolism
    Desca_2575
   00500 Starch and sucrose metabolism
    Desca_2575
   00520 Amino sugar and nucleotide sugar metabolism
    Desca_2575
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desca_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AEF95397
UniProt: F6B5G5
Position
complement(2713463..2714329)
Genome map
AA seq 288 aa AA seqDB search
MRVRKAIIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDILIVTGRNK
RAIEDHFDKSLELEIQLDHKQKHELLGLVRDISEMVDIHYIRQKEPLGLGHAVYCARKFI
GDEPFAVLLGDDVIHSKVPCLKQLINLYEEVRYSVVGVQEVPQEHVNRYGIVEAASEREG
VCRVYDLVEKPEIGQAPSRLAVMGRYILSPRIFDILAMTRPGAGGEIQLTDALRKLVQAE
AIYGCIFEGRRYDVGDKLGYLQATVEFALQRPDLAEDFRKYLKELLAD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagtccgcaaagccattataccggctgccggcctgggggtccgttttttacctgcc
accaaggcccagcccaaggaaatgctgcccattgtagataagcccaccattcaatacata
gtggaagaagccgttgcctccggcattgaagatattttaattgttaccggccgcaataag
cgggccatcgaggatcattttgacaagtccctggagttggagattcaactggaccataag
caaaagcatgaattgctgggcctggtgcgggatatcagcgagatggtagatattcactac
atccgccagaaggagcccctgggcctgggacatgcggtatattgtgcccggaagttcatt
ggcgatgagccctttgcggttttgctgggggatgacgtaattcacagtaaagtgccctgc
ttaaagcagctgattaatttatatgaggaagtacgctactcggtggtgggtgttcaggag
gtgccgcaggagcacgtcaatcgttacggcattgtggaggctgcttcggagcgggagggg
gtctgccgggtttacgatttggtggagaagccggagatcggccaggctccgtccagactg
gcagttatgggccggtatattttaagccccaggatttttgatatattagccatgaccagg
cccggcgccggcggggaaattcaattaaccgacgccttgcgcaagctggtgcaggcggag
gccatttatggctgtatttttgagggtagacgctatgacgtgggggataagttagggtac
ctccaggccacggtggaatttgccctgcaaaggccggatttggcggaggattttaggaaa
tatttaaaagagttattggctgactga

DBGET integrated database retrieval system