KEGG   Desulfotomaculum carboxydivorans: Desca_2575Help
Entry
Desca_2575        CDS       T01498                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desca_2575
   00052 Galactose metabolism
    Desca_2575
   00500 Starch and sucrose metabolism
    Desca_2575
   00520 Amino sugar and nucleotide sugar metabolism
    Desca_2575
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desca_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2713463..2714329)
Genome map
AA seq 288 aa AA seqDB search
MRVRKAIIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDILIVTGRNK
RAIEDHFDKSLELEIQLDHKQKHELLGLVRDISEMVDIHYIRQKEPLGLGHAVYCARKFI
GDEPFAVLLGDDVIHSKVPCLKQLINLYEEVRYSVVGVQEVPQEHVNRYGIVEAASEREG
VCRVYDLVEKPEIGQAPSRLAVMGRYILSPRIFDILAMTRPGAGGEIQLTDALRKLVQAE
AIYGCIFEGRRYDVGDKLGYLQATVEFALQRPDLAEDFRKYLKELLAD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagtccgcaaagccattataccggctgccggcctgggggtccgttttttacctgcc
accaaggcccagcccaaggaaatgctgcccattgtagataagcccaccattcaatacata
gtggaagaagccgttgcctccggcattgaagatattttaattgttaccggccgcaataag
cgggccatcgaggatcattttgacaagtccctggagttggagattcaactggaccataag
caaaagcatgaattgctgggcctggtgcgggatatcagcgagatggtagatattcactac
atccgccagaaggagcccctgggcctgggacatgcggtatattgtgcccggaagttcatt
ggcgatgagccctttgcggttttgctgggggatgacgtaattcacagtaaagtgccctgc
ttaaagcagctgattaatttatatgaggaagtacgctactcggtggtgggtgttcaggag
gtgccgcaggagcacgtcaatcgttacggcattgtggaggctgcttcggagcgggagggg
gtctgccgggtttacgatttggtggagaagccggagatcggccaggctccgtccagactg
gcagttatgggccggtatattttaagccccaggatttttgatatattagccatgaccagg
cccggcgccggcggggaaattcaattaaccgacgccttgcgcaagctggtgcaggcggag
gccatttatggctgtatttttgagggtagacgctatgacgtgggggataagttagggtac
ctccaggccacggtggaatttgccctgcaaaggccggatttggcggaggattttaggaaa
tatttaaaagagttattggctgactga

DBGET integrated database retrieval system