KEGG   Dickeya dadantii Ech703: Dd703_0065Help
Entry
Dd703_0065        CDS       T00927                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd703_0065
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_0065
   00052 Galactose metabolism
    Dd703_0065
   00500 Starch and sucrose metabolism
    Dd703_0065
   00520 Amino sugar and nucleotide sugar metabolism
    Dd703_0065
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dd703_0065
   00524 Butirosin and neomycin biosynthesis
    Dd703_0065
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dd703_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
76787..77908
Genome map
AA seq 373 aa AA seqDB search
MANSQPLGKTLANALSQLERLSLEPISGWASVLDIPLASAQQLMEFLEKQDIIQRKPQGI
ELHPQSPVVIGFDLGGTKVKGRLATLAGEVLAQTAHPTRKGDEQAAMQQMSSLAEDLLSQ
AGVSSQRLKQIAIGIPGSIDKQGNVQLSPNLRLPARLPAVLSLADGKPCPTVFENDVNLA
ALGEYHYGHGKGSDSLVFVAFGTGVGMGIIAQGGIISGHSGMAGEIALLPLSATPYEDAR
ISVGGVFEDRVSSSAIRQRYQGGNIEVIDIFRQAEQGEPQALAVLENTARIAALGVASAV
SLLNPEWLILGGGIGARPAFHERVRQQVEALIPVPVRLTGSALLDDAGVVGAVHLAREAC
LTALSWHDVGEPA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactctcagccacttggtaaaactcttgcaaacgcgctttctcaactggagcgt
ctgtcgttggaaccgatatccggctgggcttccgtcctcgatattccgttggcgagcgca
cagcaattgatggaatttctggaaaaacaggacattatccaacgtaaaccacagggtatc
gaattgcatccgcagtcgcccgtcgtcataggttttgatttgggcggcaccaaagtcaaa
ggccggttggcgacgctggccggcgaagtgctggcgcaaacggcgcaccctacccgcaaa
ggcgatgaacaagccgcgatgcaacaaatgtcgtcgctggcggaggatctgctcagccag
gccggcgtttcgtcgcagcggctgaagcagatcgccatcggcattcccggctcaatcgat
aaacaaggcaatgtacaactctcccccaacctgcgcttacctgcccggctgcctgctgtg
ctgtcactggcggatggcaagccatgtccgacggtattcgagaatgacgtcaatctggcg
gcgctgggggaataccactatgggcacggcaagggcagcgattcgctggtgtttgtcgcc
ttcggcaccggcgtcgggatgggcattatcgcgcagggcggcattatcagcgggcatagc
ggtatggcgggtgaaatcgcgctcttgccgctgagcgcaacgccttacgaagacgccaga
atttccgtgggcggcgtgtttgaagatcgtgtcagcagcagcgcgattcgccagcgttac
caggggggaaatatcgaggtcatcgatattttccgccaggctgaacagggcgagccgcag
gcgctcgcggtactggagaataccgcacggattgcggcgctgggtgtcgcttccgcggtg
agcctgttgaaccccgaatggctgattctgggcggcggcatcggcgcgcggccggcgttc
catgaacgggttcgccagcaggttgaggcgttgatcccggtgccggtacggcttaccggc
agcgctctgttggacgatgcgggcgtcgtcggcgccgtccatctggccagagaagcctgc
ctgacggcgttgtcttggcatgatgtgggagaaccggcatga

DBGET integrated database retrieval system