KEGG   Dickeya paradisiaca: Dd703_0227Help
Entry
Dd703_0227        CDS       T00927                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dda  Dickeya paradisiaca
Pathway
dda00860  Porphyrin and chlorophyll metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
Module
dda_M00121  Heme biosynthesis, glutamate => heme
dda_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dd703_0227
Enzymes [BR:dda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dd703_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACS84044
JGI: Dd703_0227
UniProt: C6C7C6
Position
complement(257186..257926)
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPAGEQLVARLRLAGFHAYHSPLIEFSPGRELASLPTRLAALQAGDLVFALS
QHVVEFADPLMSRGGHVWPSSLTYYAVGRTTGLALHTVSGLPVHYPPVRATSETLLQLTE
LQNIAGRHALLLRGNGGRELLGDTLQERGAIVSYCECYQRTLVHYDGAEQCQRWQTLGVN
TLVITSGEMLQALHDLVPDVYQANWLLTCRVIVVSERLAEAARKLGWSDVDVADNADNDA
LMRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggttacccgtccctctcccgcgggtgagcaactggtagcccgtctccga
ttggctggttttcacgcctaccacagtccgttaatcgaattttctcccggccgggaatta
gcgtcgttgcccacccggcttgctgcgcttcaggcaggcgatctggttttcgccttatcg
caacatgtggtggagttcgccgatccgctgatgtcacgcggcggccatgtctggcccagc
agtctgacgtactacgccgttgggcgaacgaccggattagcgctgcataccgtcagcggt
ttgccggtacattacccaccagtgcgagccaccagcgaaactctgctacaactgactgaa
ctacaaaacattgccggacggcacgccttactcttgcgcggcaacggcggtcgggaattg
ctgggcgataccttgcaggaacgaggcgccatcgtcagctactgcgaatgctatcagcgg
acgctcgtacactacgatggcgcggaacaatgccaacgttggcaaacacttggcgtaaat
acactggtcatcaccagcggggagatgctgcaagcgctccatgacctggtaccggatgtt
tatcaggccaactggctgttaacatgtcgggtcatcgtcgtcagcgagcggctggctgag
gccgctcgtaaactcggctggagcgacgtcgacgtggccgacaatgccgacaatgatgcg
ctgatgcgcgccctacaataa

DBGET integrated database retrieval system