KEGG   Dickeya dadantii Ech703: Dd703_0241Help
Entry
Dd703_0241        CDS       T00927                                 

Definition
phospholipase A (EC:3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dda00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:dda00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dda00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:dda00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
272077..272946
Genome map
AA seq 289 aa AA seqDB search
MRKTGVMAVALLMTAQVQAQDATTRKTDTGEAAQGSIIRGLLQKYDTPFILYPYESNYLL
YTYTSNINKQAIQSYSWSDHARKDEVNFQISLGFPLWRGIAGDNSLLGASYTQRSWWQMS
NKSESTPFRETNYEPQLFLGWATEYRFAGWTLQDVELGFNHQSNGRADPTSRSWNRIYAR
LMARNGPWLVEVKPWVRLHDSEDDNPDITRYMGHYRMRIGYQWGDSIFSAEGRYNWNTGY
GSGELGWSYPMTDHVRFYTKVFSGYGESLIDYNHRQTRYGIGITLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaacaggggtgatggccgtggcgttgctgatgacggcgcaggtacaggctcag
gacgccacaacgcgaaaaacggataccggcgaagcggcgcaaggcagcatcatcaggggg
ttactgcagaagtatgatacgccgttcattctgtacccttatgagagcaactatttgctc
tacacctataccagcaatatcaataaacaggcgatccagagttactcctggtcggatcat
gcccgtaaggacgaagtgaatttccagatcagcctggggttcccgctgtggcgcgggatt
gccggtgacaattccctgttgggcgcgtcatatacacaacgttcctggtggcaaatgtcc
aacaagagcgaatcgacgccgtttcgcgaaaccaactatgaaccacagctatttcttggc
tgggcgacggaataccgtttcgccggctggacgttgcaggatgtggagctgggcttcaat
catcagtccaacggccgcgctgatccgacctcccgtagctggaaccgtatctatgccagg
ctgatggcgcgcaacgggccatggctggtggaggtcaaaccctgggttcgcctgcacgac
agcgaagacgataatccggacattacccgctatatggggcactaccggatgcgtatcggc
taccagtggggcgacagcatcttcagtgccgagggccgctataactggaataccggttat
ggcagcggcgagctgggctggagctaccccatgaccgaccatgttcgcttttataccaaa
gtgttcagcgggtatggcgagtcgctgatcgactataaccatcgtcagacacgctacggc
attggtatcacgctgaacgatttgttttga

DBGET integrated database retrieval system