KEGG   Dickeya paradisiaca: Dd703_0277Help
Entry
Dd703_0277        CDS       T00927                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dda  Dickeya paradisiaca
Pathway
dda00500  Starch and sucrose metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd703_0277
Enzymes [BR:dda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dd703_0277
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd703_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACS84094
JGI: Dd703_0277
UniProt: C6C7H6
Position
314638..316821
Genome map
AA seq 727 aa AA seqDB search
MSGFSDQRVINLLFSGHYADPFAVLGMHDTPAGLEVRALLPGALEAHVVDAHNGRKVGKL
ERQDERGFFASVIPRRKHHFSYRLAVTWPRDTCIIDDPYRFGTLLQELDVWLLAEGRHLR
PFEQMGAHLRTLDGVDGACFSVWAPNAQRVSVVGDFNFWDGRRHPMRLRRESGIWELFVP
GVGVGDLYKFELIDCYGNLLLKSDPYAFESQMRPDNASLVTRLPAPLPASPERQQANDLQ
SPISIYEVHLGSWRRHTDDNFWLSYRELAEQLVPYVKSMGFTHVELMPVHEHPFDGSWGY
QPLGLYAPTRRFGSPEEFRQLVDAFHEAGINVLLDWVPGHFPADSYGLARFDGTALYEYA
DPKEGFHQDWNTLIYNFDRHEVRNYLTGNAVYWAERFGADGLRVDAVASMIYRDYSRRDG
EWVPNHYGGKENLEAISFLRYTNQTVGQHCPGLITIAEESTDYAGVTLPPEHNGLGFHYK
WNMGWMHDTLAYMQLDPVHRKFHHDLLTFGMLYAYSENFVLPLSHDEVVHGKRSLLDRMP
GDPWQKFANLRAYYGFMWAYPGKKLLFMGGEFAQGKEWNHDISLDWHLLDEPEGWHAGVQ
NLVRDLNHCYCQHPPLYQCDYLHQGFEWVVVDDRENSVFAFIRRDNDGNEMLVVSNFTPV
PREGYRIGINQPGRWREVLNTDSLHYHGGNLGNAGAVNSEPVGSHSRPQSLVLTLPPLAT
LYLVREA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtttttccgatcagcgtgtcattaatcttcttttttccggtcattatgccgat
cctttcgccgtgctgggtatgcacgatacgcccgcgggcctggaggtaagagcgctgttg
ccgggcgcgttggaggcccatgttgtggatgctcacaacggtcgcaaagtgggcaaactg
gagcgtcaggatgaacgcggctttttcgcctcggtcattccccggcgcaaacatcacttc
agttatcgtctggctgtaacctggccgcgagatacctgcattatcgacgacccttaccgt
ttcggcactctgctgcaggagctggacgtctggctgttggcggaagggcggcatctgcgg
ccgtttgagcaaatgggcgcccatctccgcacgctggatggggtggacggagcctgtttt
tccgtctgggcgccgaatgcccagcgggtttccgtcgttggggatttcaacttctgggat
ggccgccgtcatccgatgcgattgcggcgggaaagcggtatctgggaactgtttgtgccg
ggcgtcggtgtcggcgacctttataaattcgaattgatcgactgctatggcaacctgttg
ctgaagtccgacccttatgcattcgaatcccagatgcggccggacaatgcctcgctggtg
actcggcttccagcgccgctgccggcaagcccggaacggcaacaggccaacgatctgcaa
tcgcctatctctatttacgaagtgcatctgggttcctggcgtcgtcataccgacgacaat
ttctggctcagttaccgcgaactggcggagcaactggtgccgtatgtcaaatcgatgggg
ttcacccatgtcgaattgatgccggtgcatgaacacccgttcgacggcagttggggctat
cagccgttggggttgtacgcgccgacccgtcgtttcggctcaccggaagagttccgccag
ttggtggacgcttttcatgaagccgggatcaatgtgttgctggattgggtgccgggccac
tttccggcggatagctacggtctggcgcgtttcgacggcaccgctctgtatgaatacgct
gatccgaaggaagggttccatcaggactggaacaccctgatttacaacttcgaccgtcat
gaggtacgcaactacctgaccggcaacgccgtgtactgggcggagcgcttcggcgccgac
gggctgcgcgttgatgcggtggcatcgatgatttaccgcgattacagccgccgcgacggc
gaatgggtgcccaatcattacggcggcaaggagaacctggaggcgatctcttttctgcgt
tataccaaccagacggtggggcagcattgccccggcctgatcactatcgccgaagagtct
accgactacgcgggcgtgacgctgccgccggagcataacgggctcggcttccactacaag
tggaacatgggctggatgcacgacacgctggcgtatatgcagcttgatccggtgcaccgt
aaattccatcacgacctgctgaccttcggcatgctgtatgcctacagcgaaaatttcgtg
ttgccgctgtcccacgacgaagtggtgcacggcaaacgctctctgttggatcggatgccc
ggcgacccgtggcagaaattcgccaacctgcgcgcctactacggctttatgtgggcttac
cccggtaaaaagctgctgttcatgggcggcgaattcgcgcagggaaaagagtggaaccac
gacatcagcctcgactggcacctgctggatgagccggaaggctggcacgcgggggttcag
aacctggtgcgcgacctcaatcactgttattgccagcatccgccgctgtatcaatgcgac
tacctgcaccaagggtttgagtgggtggtggtggacgaccgggaaaattcggtatttgcc
tttatccgccgcgacaacgatggcaatgaaatgctggtcgtcagcaacttcacgccggtg
ccgcgcgaggggtatcgcatcggtattaatcagccgggtagatggcgggaagtgcttaat
accgactccctgcattatcacggcggcaatctcggcaacgccggggcggtcaacagcgaa
ccggtaggcagccattcccggccgcaatctctggtattgacgttgccgccgttggcgacg
ctgtatctggtcagggaggcgtaa

DBGET integrated database retrieval system