KEGG   Dickeya dadantii Ech703: Dd703_0277Help
Entry
Dd703_0277        CDS       T00927                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dda  Dickeya dadantii Ech703
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd703_0277
Enzymes [BR:dda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dd703_0277
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd703_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
314638..316821
Genome map
AA seq 727 aa AA seqDB search
MSGFSDQRVINLLFSGHYADPFAVLGMHDTPAGLEVRALLPGALEAHVVDAHNGRKVGKL
ERQDERGFFASVIPRRKHHFSYRLAVTWPRDTCIIDDPYRFGTLLQELDVWLLAEGRHLR
PFEQMGAHLRTLDGVDGACFSVWAPNAQRVSVVGDFNFWDGRRHPMRLRRESGIWELFVP
GVGVGDLYKFELIDCYGNLLLKSDPYAFESQMRPDNASLVTRLPAPLPASPERQQANDLQ
SPISIYEVHLGSWRRHTDDNFWLSYRELAEQLVPYVKSMGFTHVELMPVHEHPFDGSWGY
QPLGLYAPTRRFGSPEEFRQLVDAFHEAGINVLLDWVPGHFPADSYGLARFDGTALYEYA
DPKEGFHQDWNTLIYNFDRHEVRNYLTGNAVYWAERFGADGLRVDAVASMIYRDYSRRDG
EWVPNHYGGKENLEAISFLRYTNQTVGQHCPGLITIAEESTDYAGVTLPPEHNGLGFHYK
WNMGWMHDTLAYMQLDPVHRKFHHDLLTFGMLYAYSENFVLPLSHDEVVHGKRSLLDRMP
GDPWQKFANLRAYYGFMWAYPGKKLLFMGGEFAQGKEWNHDISLDWHLLDEPEGWHAGVQ
NLVRDLNHCYCQHPPLYQCDYLHQGFEWVVVDDRENSVFAFIRRDNDGNEMLVVSNFTPV
PREGYRIGINQPGRWREVLNTDSLHYHGGNLGNAGAVNSEPVGSHSRPQSLVLTLPPLAT
LYLVREA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtttttccgatcagcgtgtcattaatcttcttttttccggtcattatgccgat
cctttcgccgtgctgggtatgcacgatacgcccgcgggcctggaggtaagagcgctgttg
ccgggcgcgttggaggcccatgttgtggatgctcacaacggtcgcaaagtgggcaaactg
gagcgtcaggatgaacgcggctttttcgcctcggtcattccccggcgcaaacatcacttc
agttatcgtctggctgtaacctggccgcgagatacctgcattatcgacgacccttaccgt
ttcggcactctgctgcaggagctggacgtctggctgttggcggaagggcggcatctgcgg
ccgtttgagcaaatgggcgcccatctccgcacgctggatggggtggacggagcctgtttt
tccgtctgggcgccgaatgcccagcgggtttccgtcgttggggatttcaacttctgggat
ggccgccgtcatccgatgcgattgcggcgggaaagcggtatctgggaactgtttgtgccg
ggcgtcggtgtcggcgacctttataaattcgaattgatcgactgctatggcaacctgttg
ctgaagtccgacccttatgcattcgaatcccagatgcggccggacaatgcctcgctggtg
actcggcttccagcgccgctgccggcaagcccggaacggcaacaggccaacgatctgcaa
tcgcctatctctatttacgaagtgcatctgggttcctggcgtcgtcataccgacgacaat
ttctggctcagttaccgcgaactggcggagcaactggtgccgtatgtcaaatcgatgggg
ttcacccatgtcgaattgatgccggtgcatgaacacccgttcgacggcagttggggctat
cagccgttggggttgtacgcgccgacccgtcgtttcggctcaccggaagagttccgccag
ttggtggacgcttttcatgaagccgggatcaatgtgttgctggattgggtgccgggccac
tttccggcggatagctacggtctggcgcgtttcgacggcaccgctctgtatgaatacgct
gatccgaaggaagggttccatcaggactggaacaccctgatttacaacttcgaccgtcat
gaggtacgcaactacctgaccggcaacgccgtgtactgggcggagcgcttcggcgccgac
gggctgcgcgttgatgcggtggcatcgatgatttaccgcgattacagccgccgcgacggc
gaatgggtgcccaatcattacggcggcaaggagaacctggaggcgatctcttttctgcgt
tataccaaccagacggtggggcagcattgccccggcctgatcactatcgccgaagagtct
accgactacgcgggcgtgacgctgccgccggagcataacgggctcggcttccactacaag
tggaacatgggctggatgcacgacacgctggcgtatatgcagcttgatccggtgcaccgt
aaattccatcacgacctgctgaccttcggcatgctgtatgcctacagcgaaaatttcgtg
ttgccgctgtcccacgacgaagtggtgcacggcaaacgctctctgttggatcggatgccc
ggcgacccgtggcagaaattcgccaacctgcgcgcctactacggctttatgtgggcttac
cccggtaaaaagctgctgttcatgggcggcgaattcgcgcagggaaaagagtggaaccac
gacatcagcctcgactggcacctgctggatgagccggaaggctggcacgcgggggttcag
aacctggtgcgcgacctcaatcactgttattgccagcatccgccgctgtatcaatgcgac
tacctgcaccaagggtttgagtgggtggtggtggacgaccgggaaaattcggtatttgcc
tttatccgccgcgacaacgatggcaatgaaatgctggtcgtcagcaacttcacgccggtg
ccgcgcgaggggtatcgcatcggtattaatcagccgggtagatggcgggaagtgcttaat
accgactccctgcattatcacggcggcaatctcggcaacgccggggcggtcaacagcgaa
ccggtaggcagccattcccggccgcaatctctggtattgacgttgccgccgttggcgacg
ctgtatctggtcagggaggcgtaa

DBGET integrated database retrieval system