KEGG   Dickeya dadantii Ech703: Dd703_0315Help
Entry
Dd703_0315        CDS       T00927                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dda  Dickeya dadantii Ech703
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd703_0315 (malQ)
Enzymes [BR:dda01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dd703_0315 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
359987..362110
Genome map
AA seq 707 aa AA seqDB search
MVLKAKKSVRYPVGLVDTYKDAYGNEQVIAEETREKLMQLLAPQDIAGARLPPVCVFRQG
KAMTLKPGGEGDYGWIITYEKGGGTEGKVSAGQVLSLPDTLPIGYHQLVLEQGEKQWSCR
IIVAPSGCYEPEPLTNGRRWWGITVQLYTLRSQHNWGIGDFGDLKSLVENVARRGGAFVG
FNPLHSLYPAEPEAASPYSPSSRHWLNIIYIDVNQVEDFHHSEAAQAWWRRDDIQRQVLV
ARTNRWVDYTSVTTLKLAALRLAFQHFCRRSPLDHRKTALQQFIRNGGESLQQQATYDAL
LVYLKAQGDIPADWRRWPEEYREAGGDAVMRFRQENAEEIQFYCWLQWVAHEQLAACFER
SRQLGMPIGLYRDLAVGGAQGGVDTWGDRQLYCLDVTLGAPPDPLGPQGQNWNLTPMHPY
ALQQRGYQPFIDMLRRNMASSGALRIDHVMGLLRLWWIPGGDTAAGGAYVRYPVDDLLAI
VALESQRYRCLVIGEDLGTVPEEVVQRLEENGIYSYKVLFFEKDRKNRYRAPCEYPRRSM
ATITTHDLPTLRGFWQGMDLTLGKDLGLYPSDEILQLQLEERELAKQGMLDALHEQGLLP
QRVGRNAALTSMSSHLNRGVQRYLADSASALLGLQLEDWLDMATPVNVPGTDREYPNWRR
KLSRTLDSIFTDRNLERLIRDIDLRRGGPVPVRGRKKKTDATPSADA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggtgttaaaggcaaagaaatccgttcgttatccggtagggctcgttgacacctataaa
gatgcttatggcaatgaacaggtgatagccgaagagacccgggagaagctgatgcaattg
ctcgccccacaggatatcgccggggcgcgcttgccgccggtgtgcgtttttcgtcagggc
aaggccatgacgttgaagcctgggggggaaggagactacggatggattatcacttatgaa
aaagggggcgggacggaagggaaggtatcggctgggcaggtactgtcgttacccgacaca
ttgcctatcggttatcaccagctggtgttggagcaaggggaaaaacagtggtcatgccgg
atcatcgttgcgccgtcgggttgctatgagcccgaaccgctgacgaatggccgccgctgg
tgggggatcaccgtgcagctttataccctgcgttcacagcataactggggcatcggcgat
tttggcgatctgaagtcgctggtggaaaatgtggcgcgccggggcggcgctttcgtcggg
ttcaatccgttgcactcgctctacccggcggaaccggaagccgccagcccctacagccca
tcatcccgccactggttgaacatcatctatatcgatgtcaatcaggtggaggattttcac
cacagcgaagccgcccaggcgtggtggcggcgtgacgatattcagcgacaggtgttggtc
gcccgcaccaaccgctgggtggactatacctcggtgacgacgctgaagctggcggcgttg
cgtctggcgttccagcatttttgccgtcgcagcccgctggatcatcgcaaaacggcgttg
cagcagttcatcaggaatggcggtgagagtttgcagcaacaggcgacctatgatgcgttg
ttggtttacctgaaagcgcaaggcgacattccggcggactggcggcgatggccggaggag
taccgtgaggcaggcggggacgcagtcatgcgttttcgtcaggaaaatgccgaggagatc
cagttttactgttggctgcaatgggtggcgcatgaacagttggccgcctgttttgagcgt
agccgccaactgggtatgcccatcggattgtaccgcgacctggcggtcggtggggcgcag
ggcggcgtggatacctggggggacaggcagctgtactgtctggatgtgacgctgggcgcg
ccgcctgatccgctggggccgcaggggcaaaactggaacctgacgccgatgcatccgtat
gcgttgcaacagcgtggctaccagccgtttatcgatatgttgcgccgtaatatggccagc
agcggcgcgttacgtatcgatcacgtcatggggttgctgcgtctgtggtggatcccaggc
ggcgacaccgcggcgggcggcgcctatgtgcgctacccggtggatgacctgttggcgatc
gtggcgcttgagagccagcgctatcgctgtctggtgatcggcgaggatctgggcaccgtc
ccggaagaggtggtgcagcggctagaggagaacggtatctattcctataaggtgctgttt
ttcgaaaaggatcggaaaaatcgctaccgtgcgccgtgcgaatatcctcgccgctcgatg
gcgaccatcaccacgcacgatttgccgacgctgcgtggtttctggcaagggatggatctg
acgttgggcaaggatttggggctctatcccagcgatgaaattttgcaacttcagctggag
gagcgcgaacttgctaagcagggcatgctggatgcgttgcatgaacaagggttgttgccg
cagcgggtcgggcgcaatgcggctctgacgtcgatgagttcgcacctgaaccgcggtgtt
cagcgctatctggcggatagcgccagtgcgttgttggggttgcaactggaggactggctg
gatatggcgacgccggtcaatgtgccgggtaccgatcgggaatatcccaactggcggcgc
aaattgagccgtactctggactccatttttaccgatcgcaatctggaacgtctgatccgt
gatatcgatctgcggcgcggtgggccggtaccggtacgcggacgtaagaaaaaaactgat
gccacgccgtcggcggatgcgtaa

DBGET integrated database retrieval system