KEGG   Dickeya paradisiaca: Dd703_0451Help
Entry
Dd703_0451        CDS       T00927                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dda  Dickeya paradisiaca
Pathway
dda00630  Glyoxylate and dicarboxylate metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01200  Carbon metabolism
Module
dda_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dd703_0451
Enzymes [BR:dda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Dd703_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ACS84262
JGI: Dd703_0451
UniProt: C6C8P1
Position
485667..486977
Genome map
AA seq 436 aa AA seqDB search
MSITSRTQQIRQLEQEWKTPRWEGIVRPYRTEDVINLRGSVNPACTLAQRGAEKLWALLH
GESRKGYINCLGALTGGQALQQAKAGLEAVYLSGWQVAADANLAANMYPDQSLYPANSVP
AVVQRINGTFRRADQIQWANGIEPGDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIEA
GAAAVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVLGVPTLLVARTDADAA
DLLTSDCDSYDQDFVTGERTVEGFFRTRAGVEQAISRGLAYAPYADLVWCETSTPDLALA
RRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDRAIARFQDELSEMGYKYQFITLAGIHSM
WFNMFDLAHAYAQGEGMKHYVEKVQQREFAAISEGYTFSSHQQEVGTGYFDKVTTIIQGG
SSSVTALTGSTEEQQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcattacctctcgtacccaacaaatccggcaactcgaacaggaatggaaaaccccg
cgctgggaaggcattgtccgcccttatcggacagaggatgtgattaacctgcgcggctcg
gtgaatccagcttgtacgctggcgcagcgaggcgcggagaaactgtgggccttgctgcac
ggagaatcgcgtaagggatacatcaattgtttgggcgcgctgaccggcggccaggcgttg
cagcaggcgaaagccggtctggaagcggtgtacctgtcgggttggcaggtcgcggcggac
gctaacctggccgccaatatgtaccccgaccagtcgctttatccggcgaactcggtaccg
gccgtggtgcagcgcatcaacggcacctttcgtcgtgcggatcagatccagtgggcgaac
ggcattgaaccgggcgatccgcgttttatcgactatttcctgccgatcgtggcggatgcg
gaagccggattcggcggcgtactgaacgcatttgagctgatgaaatcgatgattgaggcg
ggcgcggcggcggttcatttcgaagatcaactggcctcggtgaagaagtgcggccacatg
ggtggcaaggtgctggtgccgacgcaggaagcggtgcagaaactggtcgctgcacgtctg
gcggcggatgtgctgggcgtgccgacgttgctggtcgcccgtaccgatgcggatgcggca
gatctgctgacctccgactgcgacagctacgatcaggatttcgtcactggcgaacggacc
gttgaggggttcttccgtactcgcgccggcgtggaacaggctatcagccgcgggttagcc
tacgcgccgtatgccgatctggtgtggtgcgaaacctcgacaccggatttggctctggct
cggcgcttcgccgaagccattcacgcccgcttccccggcaaactgctggcctacaactgt
tctccgtcgttcaactggaaaaagaacctggatgaccgtgctatcgcccgttttcaggat
gaactgtccgagatgggctacaagtaccagttcatcacgctggccgggatccacagcatg
tggttcaacatgtttgatctggcccatgcctatgcacagggcgaagggatgaagcattac
gtcgagaaggtacagcagagagaattcgctgcaatttcagaagggtacactttctcctcc
catcagcaggaggtgggaaccggctacttcgacaaagtcacgaccattattcagggcgga
tcctcttccgtcacggcgttgaccggttcgacggaagaacagcagttctga

DBGET integrated database retrieval system