KEGG   Dickeya dadantii Ech703: Dd703_0574Help
Entry
Dd703_0574        CDS       T00927                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd703_0574
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd703_0574
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dd703_0574
Enzymes [BR:dda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dd703_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
644992..646281
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVNFAEAIRKGLGSQQGLFFPLELPEFDLTAIDELLQLDFVTRSSRILS
AFIGDEMPDETVYQRVKAAFRFPAPVVPVSADISSLELFHGPTLAFKDFGGRFMAQMLAE
VAGDEQITILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIHTI
AVDSDFDACQALVKQAFDDEELKQTVGLNSANSINISRLLAQICYYFEAVAQLSQDARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLQNGSWQPNPTVATLSNA
MDVSQPNNWPRVEELFRRKNWSLKTLGFGAVSDEVTKTTMRELDALGYVSEPHAAIAYRL
LRDQLQPGEHGLFLGTAHPAKFKESVEEILGKALPLPQELATRADLDLLSHHFAPDFAQL
RQFLMALPR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatctgaaagatcataacgaacaggtgaattttgccgaagccatcaga
aaagggctcggcagccagcagggcctgtttttccctctggagttgccggaatttgacctg
acggcgatcgacgaattgctgcagttggattttgtcacccgcagcagtcgtattttgtcg
gcgtttatcggcgatgaaatgccggatgagacggtatatcagcgtgttaaagcggcgttt
cgttttccggcgccggtggtgccggtaagcgcggatatctcctcgctggagttgttccat
ggcccgacgctggcattcaaagatttcggcggccggtttatggcgcagatgctggcggaa
gtggcgggcgacgagcagatcaccatcctgaccgccacgtctggcgataccggcgcagcg
gtggcgcatgcgttttacggcctggagaatgtgcgcgtggttatcttgtatccgcgcggc
aagatcagcccgctgcaggagaaattgttctgtacgcttggcggcaatattcacaccatt
gccgtcgacagcgactttgatgcctgccaggcgctggtcaaacaggcgtttgatgacgaa
gaactgaagcagacggtggggctcaactcggccaactccatcaatatcagtcgcctgttg
gcgcagatctgttattactttgaggcggtggcgcaactgtcgcaggacgcgcgcaaccaa
ctggtgatttcggtgcccagcggtaatttcggcgatttgaccgccggtctgctggcgaaa
tcgctggggctgccggtgaagcgttttatcgccgccaccaacgccaacgacacggtgccg
cgttttctgcaaaacggcagctggcagccgaatccgacggtcgccacactctccaacgcc
atggacgttagccaacccaacaactggccgcgggtagaagaactgttccgccgtaagaac
tggtcgctgaaaacgctgggctttggcgcagtcagcgatgaggtcactaaaaccaccatg
cgggagctggatgcgttgggatatgtttccgaaccgcatgcggcgatcgcctaccgcctg
ctgcgcgatcagctacagcccggtgagcatggcctgttcctggggacggcgcacccggcg
aaattcaaggaaagcgtggaagagattctggggaaagccctgccgttgccgcaggagctg
gccacgcgcgccgatctggatttgctgtcccatcactttgcgcctgatttcgcccagttg
cgtcagttcctgatggcgttgccgcgttaa

DBGET integrated database retrieval system