KEGG   Dickeya dadantii Ech703: Dd703_0599Help
Entry
Dd703_0599        CDS       T00927                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dda  Dickeya dadantii Ech703
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dda00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dda00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
674712..675209
Genome map
AA seq 165 aa AA seqDB search
MMISLIAALAVDRVIGKENAMPWHLPADLAWFKRNTLNKPVIMGRHTYRSIGKPLPGRLN
IVVSSQPGDDERVIWAASLDEALLAAGDVEEVMVIGGGKVYQQMLPKAGRLYLTHIDAEV
EGDTHFPEYEPDEWVSIFSEFHDADEHNSHSYCFEILDRRECGAM
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatgattagtttgattgccgcactggcggtggatcgggttatcggtaaggagaatgct
atgccgtggcatttaccggccgatctggcatggttcaagcgtaatacgctgaacaagccg
gtaattatggggcgtcatacctaccgctcgattggcaagccgttaccgggacgactgaat
atcgtggtgagcagccagccgggcgacgacgagagggtgatctgggccgcatcgctggat
gaagccttactggcggcgggcgacgtggaagaagtcatggtgattggcggcggcaaggtt
taccagcaaatgttgccgaaagcgggtcgtctttacctgacacatattgatgcggaagtg
gaaggggatacgcactttccggaatatgagccggacgaatgggtatcgatattcagcgag
ttccacgacgcggatgagcacaattcccacagttactgcttcgaaattctggaccgtcgt
gagtgtggcgcgatgtga

DBGET integrated database retrieval system