KEGG   Dickeya paradisiaca: Dd703_0599Help
Entry
Dd703_0599        CDS       T00927                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
dda  Dickeya paradisiaca
Pathway
dda00670  One carbon pool by folate
dda00790  Folate biosynthesis
dda01100  Metabolic pathways
Module
dda_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dd703_0599
   00670 One carbon pool by folate
    Dd703_0599
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dd703_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ACS84410
JGI: Dd703_0599
UniProt: C6C9F9
Position
674712..675209
Genome map
AA seq 165 aa AA seqDB search
MMISLIAALAVDRVIGKENAMPWHLPADLAWFKRNTLNKPVIMGRHTYRSIGKPLPGRLN
IVVSSQPGDDERVIWAASLDEALLAAGDVEEVMVIGGGKVYQQMLPKAGRLYLTHIDAEV
EGDTHFPEYEPDEWVSIFSEFHDADEHNSHSYCFEILDRRECGAM
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatgattagtttgattgccgcactggcggtggatcgggttatcggtaaggagaatgct
atgccgtggcatttaccggccgatctggcatggttcaagcgtaatacgctgaacaagccg
gtaattatggggcgtcatacctaccgctcgattggcaagccgttaccgggacgactgaat
atcgtggtgagcagccagccgggcgacgacgagagggtgatctgggccgcatcgctggat
gaagccttactggcggcgggcgacgtggaagaagtcatggtgattggcggcggcaaggtt
taccagcaaatgttgccgaaagcgggtcgtctttacctgacacatattgatgcggaagtg
gaaggggatacgcactttccggaatatgagccggacgaatgggtatcgatattcagcgag
ttccacgacgcggatgagcacaattcccacagttactgcttcgaaattctggaccgtcgt
gagtgtggcgcgatgtga

DBGET integrated database retrieval system