KEGG   Dickeya dadantii Ech703: Dd703_0817Help
Entry
Dd703_0817        CDS       T00927                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dda  Dickeya dadantii Ech703
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dda00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
925526..926266
Genome map
AA seq 246 aa AA seqDB search
MLEHICQLARDAGEAIMQVYNGHQPIDVARKQDDSPITAADLAAHQVIKRGLESRYPDIP
LLSEEDPPAWSVRQTWQRYWLVDPLDGTKEFINRNGEFTVNIALIEEGKPVLGVVYVPVT
GVMYAAAGGKAWKEEGGQRHQIQVYDARPPVVVVSRSHADAELEDYLSQLGEHRTVSVGS
SLKFCLVAEGRAQLYPRFGPTSVWDTAAGHAVALASGAQVTDWQGKPLSYRPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacatatctgccaactggcgcgggacgccggcgaggcgatcatgcaggtttat
aacggtcatcagcctatcgacgtggcccgcaaacaagatgattcaccgataacggcggcg
gatctggcggcgcaccaggtgatcaagcgggggctggagagtcgttacccggatattcct
ctgctgtcggaagaggatccccccgcctggtcggtacgccagacgtggcaacgttattgg
ctggtcgacccgctggacggtaccaaggaattcatcaatcgtaacggcgagtttaccgtc
aacattgcgttgattgaggaaggtaaaccggtgctgggcgtggtgtatgtgccggtgact
ggcgtgatgtacgccgcggccggggggaaagcctggaaagaagagggcgggcagcgtcat
cagattcaggtgtatgacgctcggccgccggtggtggtggtgagccgctcccatgcggat
gccgagctggaggattacctgagccagctcggtgaacaccgcacggtgtcggtcggctca
tcgctgaagttttgtctggtggcggaaggccgcgctcagctttatccccgttttgggccc
accagcgtctgggataccgccgccggccatgctgtggcgctggcctctggcgcgcaagtg
accgactggcagggtaaaccgctctcctaccgcccgcgggagtcatttctcaatccgggg
tttcgtgtctccctgttctga

DBGET integrated database retrieval system