KEGG   Dickeya dadantii Ech703: Dd703_0935Help
Entry
Dd703_0935        CDS       T00927                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dda  Dickeya dadantii Ech703
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd703_0935
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dd703_0935
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dd703_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1067114..1068217
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPPTIATKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRERFLNARDT
MRALLDNHIVPIINENDAVATAEIKVGDNDNLSALAAMLADADKLLLLTDQAGLFTADPR
SNPDAELIREVQGITDELRQIAGGSVSGLGTGGMSTKLQAADVACRAGIDVIIAAGSRQG
VIGDVINDVSVGTRFHALETPLESRKRWIFGAPPAGEITVDDGASVAILERGSSLLPKGI
RHVDGNFSRGEVIRIRNLAGRDLAHAVTRYNSDALRMIAGHHSQQIADILGYEYGPVAVH
RDDMIIN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagccagactttggttgtaaaactgggcaccagcgtgctgacaggggggtcg
cgtcgcctgaaccgtgcccatatcgttgaactggtgcgtcagtgcgcccagcagcatgca
gcggggcatcgtattgtcattgtgacgtctggcgcgattgcggctgggcgtgaacatctg
gggtatccggagttgccgcctactatcgccaccaaacagttgctggcggcggtagggcag
agccgactgattcaattgtgggagcaactgttttccatctacggcattcatgttgggcag
atgctgttgacgcgcgcagacctggaggatcgtgagcgtttcctcaatgcccgcgatacc
atgcgcgctctgcttgataaccatatcgttcccattattaacgaaaatgacgcggtcgct
acggccgaaatcaaagtcggcgataacgataatttgtccgcattggctgcgatgttggcg
gatgccgacaagctgctattgttgacggatcaggccgggttgtttactgccgacccgcga
tccaaccctgacgcggagttgatccgtgaagtgcagggcattacggatgaattgcgacaa
atcgccggcggcagcgtttctggtttggggactggcggcatgtccaccaaactacaggcg
gcggatgtcgcctgtcgcgccgggatcgatgtcattatcgctgcaggcagccgccagggc
gtgatcggcgatgtgatcaatgatgtgtcggtcggaacccgctttcatgcgctggaaacg
ccgctggaaagccgcaagcgttggattttcggtgcgccgccggccggtgaaatcactgtg
gacgacggtgcgtcggtggcgattctggagcgaggcagttccctgttgccgaaaggcatc
cgccatgtggacggcaatttttcccgcggtgaggtgattcgcattcgtaacctggcgggc
cgggatctcgcgcatgccgtcactcgttacaatagcgatgcgctgcggatgatcgccggg
catcattcccagcaaatcgccgatatcctcggttatgaatatggcccggtggcagtccat
cgggacgacatgattatcaattaa

DBGET integrated database retrieval system