KEGG   Dickeya dadantii Ech703: Dd703_1021Help
Entry
Dd703_1021        CDS       T00927                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dda  Dickeya dadantii Ech703
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dda00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd703_1021
DNA repair and recombination proteins [BR:dda03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dd703_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1166918..1167523
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMDALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCTICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
GDIGLDRLEARLATESISEVILATNPTVEGDATANYIAELCAEHGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPIKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgcttcttgaatcgttgatggatgcgctgcgctgtctgccgggtgtc
gggcccaagtcagcgcagcgcatggcttttcatctgttgcaacgcgatcgcagcggcggt
atgcggttggcgcaggcgctgacccgcgccatgtcggagatcggtcattgcgccgattgc
cggacgttcaccgagcaggacgtttgcacgatttgcgccaatccgcgccgtcagcagaac
gggcagatttgcgtggtggaaagcccggcggatatccacgccatcgagcagaccgggcag
ttcgcagggcgttacttcgtattgatggggcacctgtcgccgctggatggcatcgggccg
ggcgatatcgggctggatcggctggaagcgcgtctggcgactgaatccatcagcgaagtg
attctggccaccaatcctacagtcgaaggggatgccacggccaactacattgctgaactt
tgcgccgaacatggcgtgatggccagccgtatcgcccacggcgtgccggtcggcggcgag
ctggaaatggtcgatggcaccacgttgtctcattcgctggccggtcgtcatccgatcaaa
ttctga

DBGET integrated database retrieval system