KEGG   Dickeya dadantii Ech703: Dd703_1031Help
Entry
Dd703_1031        CDS       T00927                                 

Definition
copper-translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
dda  Dickeya dadantii Ech703
Brite
Enzymes [BR:dda01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Dd703_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1179924..1182665)
Genome map
AA seq 913 aa AA seqDB search
MSQTVLLSLQGLSCEHCVGRVKKALESRPDVEKADVSLTYANVTGEVGSSALIDTIVQAG
YEASPATTPDTTLSLSGLNCQHCVASTRKALEAVAGVSAVDVSLEQARIYGSADAQTLVS
AVEQAGFHAAPAEASSLPKSEPLAPTDASPEHLSAASATHPANTVSGNDDDSVQLLLEGM
SCASCVARVQQALQNVPGVTQARVNLAERSALVSGNAPHQALISAVENVGYGAEIILDEA
ERRTRREQTAQAAMRRFRWQAALGMLLGIPLMLWGLFGDGMMLTDSNRAGWLAIGVLTLA
VMAIAGNHFYRNAWRSLRNGSATMDTLVALGTGVAWLYSITVNLWPDKFPMEARHLYYEA
SAMIIGLINLGHALEQNARQRSSQALERLLDLTPPTARLVTPQGDRQIPLSEIQAGMRLR
LTTGDRVPVDGCIEQGELWLDEAMLTGEPLPQQKNGGDTLHAGTQVQDGSAIFQAQAIGN
QTTLARIIRLVRQAQSSKPAIGQLADRISAVFVPVVVAIALLSGAIWYAVGPEPRLVYTL
VIATTVLIIACPCALGLATPMSIIAGVGRAAELGVLVRDADALQQASQLDVLVFDKTGTL
TEGKPRVVAIHTFGGASEQQVLAWAASLEQGASHPLARAIVERAQGVPLHIIETFRTLPG
LGISGQCGTVELLLGNPALLTQHGINLTAPTGERSPQQSLEQLAQQGITPVLLAADNNVV
ALFAIQDTLRQDSIPALKRLHRQGYQLVMLTGDNPATAHAIAQVAGIDQVIAGVLPDGKA
DAIRQLQAGGRKVAMIGDGINDAPALAQADVGIAMGGGSDIAVETATMALMRHSLQGVAD
ALELSKATLGNMKQNLLGAFVYNSLGIPIAAGLLYPFTGTLLSPVVAGAAMALSSITVVS
NANRLLRFSPGAR
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaccgttttgttatcgctccagggattatcctgcgagcattgcgtcggcaga
gttaaaaaggcgctggaatcacgccctgacgtggaaaaagctgacgtatcattgacctac
gccaacgttaccggcgaagtgggcagctcggcgctgatagacaccatcgttcaagccggg
tatgaagccagcccggccactacgccggacaccacgttgtcgctctccggcctcaactgt
cagcattgcgtcgcctcgacccgcaaggcgctggaagcggtcgctggcgtcagcgccgta
gacgtctcgctggaacaggcccggatttacggcagcgccgatgcgcaaacactggtcagc
gccgtcgagcaggccggatttcatgcagccccggcagaggcgtcttcactcccaaaatct
gagccgctggcaccgacagacgcttcgccggagcacctgtcagcggcatctgcaacacat
ccggccaacaccgtctccggcaacgatgacgacagcgtacagctcttgctggaaggcatg
agctgcgccagttgcgtcgcccgggtacaacaggcgctgcaaaacgttcccggcgtgacg
caagcgcgcgtcaatctggccgagcgcagcgcgctggtcagcggaaatgcgccgcatcag
gccctgattagcgcagtggaaaacgtcgggtacggcgccgaaattattttagacgaggcg
gaacgccgcacccgacgcgaacagaccgcccaggcagccatgcgccgcttccgctggcaa
gcggcattggggatgctgttaggcattccgctgatgctatggggtctctttggcgacggc
atgatgctgaccgacagcaaccgcgccggctggctggcgatcggcgtactgacgctggcg
gtgatggcgatcgccggcaaccatttctaccgcaatgcctggcgcagcctgcgcaacggc
agcgccaccatggatacgctggtggcgctgggcaccggcgtagcctggctttactccatc
accgtcaacctgtggcccgacaagtttccgatggaagcacgccacctgtattacgaagcc
agcgccatgatcatcgggttaatcaacctcggccatgcgctggaacaaaatgcccgccag
cgttcatcgcaggcgctggaacgtctgctcgacctgacgccgccgacggccaggctggtc
acgccgcagggcgatcgccaaattccgctgtccgagatccaggcagggatgcgcctgcgg
ctgaccaccggcgaccgcgtcccggtcgacggctgcattgaacagggcgaactatggctg
gacgaagccatgctgaccggggagccgctcccacagcaaaaaaacggcggtgatactctc
cacgccgggactcaggttcaggatggcagcgcgattttccaggcgcaggctatcggcaat
caaacgacgctggctcggatcatccggctggtgcgtcaggcacagagcagcaagccggcg
atcgggcaactggcggatcgcatctcggccgtctttgtccccgtcgtggtggcgatcgca
ttgctgagcggcgccatctggtatgccgtcgggccggagccccggctggtttatacgctg
gttatcgccactaccgtactgattatcgcctgcccttgcgcactgggcctggccacgccg
atgtcgatcattgccggcgttggccgggcggcagaacttggcgttctggtcagggatgcc
gacgcgctgcaacaggccagccaactggatgttctggtgttcgataaaaccggcacgctg
acggaagggaaaccccgcgtggtcgccatccatacatttggcggcgccagcgaacagcag
gtgctggcgtgggcggcctcgctggaacaaggcgccagccacccgctggcgcgagccatc
gtcgaacgtgcgcagggcgttccgctacacatcattgagacattccgcaccctgccgggg
ctcggcatcagcggtcagtgcggaacagtcgagctgctgctgggcaatccggcgttactg
acccaacatggcatcaacctgacggcgccgacgggtgaacgctcgccgcagcaaagcctg
gaacagttggcgcagcaagggatcacaccggtgttgctggcggcggacaacaacgtcgtg
gcgctgttcgctattcaggacaccttacggcaggacagcatccccgcgctgaaacgcctg
catcgccagggttatcaactggtgatgctgaccggcgacaacccggccaccgcccacgcc
atcgcgcaggtagccggtatcgatcaggttatcgccggcgttctgccagacggcaaagcc
gatgccatccggcagttgcaggcgggcggacggaaagtcgcgatgatcggcgacggcatc
aacgatgccccggcactggcgcaggcggatgtcggcatcgccatgggcggcggcagcgat
atcgcggtggaaactgcgaccatggcgctgatgcgtcacagtctgcaaggtgtggcggat
gcgcttgaactgtcgaaagccacgctgggcaacatgaagcagaacctgctgggcgccttc
gtctataactcgctggggatccccatcgccgccggtttactctacccgtttaccggcacc
ttgctcagcccggtggtggcgggcgcggccatggcactgtcctccatcaccgtggtcagc
aatgccaaccggttactgcgtttttcacccggcgccagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system