KEGG   Dickeya dadantii Ech703: Dd703_1054Help
Entry
Dd703_1054        CDS       T00927                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dda  Dickeya dadantii Ech703
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dd703_1054
Enzymes [BR:dda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dd703_1054
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dd703_1054
Lipid biosynthesis proteins [BR:dda01004]
 Fatty acid synthase
  Component type
   Dd703_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1211641..1212279)
Genome map
AA seq 212 aa AA seqDB search
MMNFKNVFRWHLVVSLFLCLFSLRALATDTLLVLGDSLSAGYRMAGNQAWPELLNDRWRA
HTPDIQVVNASISGDTAAQGLARLPALLNQHQPRWVLIELGGNDGLRGFPPQNLERDLSN
IIARIKTANAEPLLMQIRLPSNYGRRYTETFSAVYPRLAQQFSIPLLPFFMEQVYLKPEW
MQDDGIHPTRDAQPFIADWMARQLEPLVNHDS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaatgttttccgctggcatctggttgtctctctgtttctgtgcctg
ttcagtttacgtgcgctggcgacggacaccctgctggtgctgggcgatagcctgagcgcg
ggataccggatggcgggcaatcaggcgtggccggaattgctcaacgatcgctggcgcgcc
catacgccggatattcaggtggtcaacgccagcatcagcggcgataccgctgcccagggg
ctggctcggctgcctgcactgttgaaccagcatcagccgcgttgggtgctgatcgaactt
ggcggcaacgacgggctgcgaggctttcccccgcaaaatctggagcgggatctcagcaac
atcattgcgcggatcaaaacggccaacgccgaaccgctactgatgcaaatccgcttgcca
agcaactatggtcgacgttataccgaaacgttcagcgccgtttatccgcgtctggcccaa
caattttcgattcctctgctgccgtttttcatggagcaggtctatctgaagccggaatgg
atgcaggatgacgggatccacccaacacgcgatgcccagccgttcatcgccgattggatg
gccagacagcttgaaccgttagttaaccacgactcttga

DBGET integrated database retrieval system