KEGG   Dickeya paradisiaca: Dd703_1080Help
Entry
Dd703_1080        CDS       T00927                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dda  Dickeya paradisiaca
Pathway
dda00300  Lysine biosynthesis
dda01100  Metabolic pathways
dda01120  Microbial metabolism in diverse environments
dda01230  Biosynthesis of amino acids
Module
dda_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Dd703_1080
Enzymes [BR:dda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Dd703_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACS84885
JGI: Dd703_1080
UniProt: C6CC74
Position
complement(1240114..1241241)
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELAQQLIQRPSLSPDDAGCQELMIERLHNIGFTIERMDFGDTRNFWAWRGNGKT
LAFAGHTDVVPTGDAGLWKFPPFEPTCHEGMLYGRGAADMKGSLAAMVVAAERFVATHPH
HQGRLAFLITSDEEAKATYGTVKVVEALMARQERLDYCLVGEPSSTERLGDVVKNGRRGS
ITANLRIHGIQGHVAYPHLADNPVHRAMPALNELVSTIWDEGNEFFPPTSMQIANIQAGT
GSNNVIPGELYVQFNFRFSTELTDETIKQRVQALLDRHQLDYTLEWWLSGHPFLTARGAL
VDAVVSAVEHHSQMTPQLLTNGGTSDGRFIARMGAQVVELGPVNATIHKVNECVSADDLS
LLSNMYQHIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttgcccggtaatcgaactggcccaacagcttatccaacgaccatccctcagcccg
gacgatgccggttgtcaggagctgatgatcgaacgcctgcataatatcggttttactatt
gaaagaatggattttggcgatacacgtaatttttgggcatggcgtggcaacggaaaaacg
ctggcctttgccggacataccgatgtcgttccaactggcgacgctgggctatggaaattt
cccccctttgagccaacatgccatgaaggcatgctatacggccgtggcgcagctgatatg
aaaggctcactggccgccatggttgttgctgcagaacgttttgtcgccactcatccccat
caccaggggaggttagcgttcctgattacctcggatgaagaagccaaagcgacgtatggt
acggtcaaagtggttgaagccctcatggcccgccaggaacggctggattattgtctggtt
ggcgaaccctccagtaccgagcgcctcggagacgtcgtcaaaaacggtcgacgcggctct
atcaccgctaacctgcgcattcatggcattcaagggcatgttgcctatcctcatctggcg
gataacccggtacaccgggcgatgccggcgctgaacgagttggtttcaaccatctgggat
gaaggcaatgagttttttccccccaccagcatgcagatagccaacatacaagctggcacg
ggaagtaataacgtcatccccggcgaactctatgtgcagttcaactttcgattcagcacc
gagctaacggatgaaaccataaaacaacgagtacaggcgctactcgatcgccatcagctt
gattacacactggagtggtggttgtcagggcatccgtttttgacggcacgaggagcactg
gtggatgccgtcgtcagcgcggtggaacatcacagccagatgaccccacaactgctgact
aacggcggcacatcggatggcaggtttatcgctcgcatgggggcgcaagtggtggagctc
gggccggtaaacgccaccatccataaagtgaatgagtgcgtcagcgcagatgatttatcg
ctactaagcaacatgtatcagcacatcatggagcaactcatcgcatga

DBGET integrated database retrieval system