KEGG   Dickeya dadantii Ech703: Dd703_1145Help
Entry
Dd703_1145        CDS       T00927                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dda  Dickeya dadantii Ech703
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd703_1145
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd703_1145
  Amino acid metabolism
   00310 Lysine degradation
    Dd703_1145
Enzymes [BR:dda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dd703_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1311847..1313067
Genome map
AA seq 406 aa AA seqDB search
MSSIDILVPDLPESVADATVATWHKQPGDSVQRDEVLVEIETDKVVLEVSAIEAGVLDVI
LEAEGATVTARQVLGRLRPGDNSGKETSAKAQLQESTPAQRHTAGLDEESNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEKHLAGKSAPKAVAPVAAPSQPTQALGSRSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGVRLGFMSFYI
KAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDLMGMADIEKRI
KELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAID
GQVVILPMMYLALSYDHRQIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcatagatattcttgtacctgacctgcctgaatccgtggcggatgctacggtg
gcgacctggcacaaacaaccgggggatagcgtccagcgtgatgaggtactggttgaaatt
gaaactgataaagttgtactagaagtgtctgcgattgaagctggcgtgctagacgtgatt
ctggaagctgagggggcgacggtgacagcgcgccaggtacttgggcgtttacgtccaggc
gataattccggcaaggaaaccagtgctaaagctcagcttcaggagtcaacgccggcccaa
cgtcataccgcgggcctggatgaagaaagtaacgacgcactcagcccggcgattcgacgc
ctgatcgccgagcacgatctggatgctgcggcgattaaggggagtggggtcggtggtcgg
attacccgcgaagatgtagaaaaacatttggcaggcaaaagtgctccgaaggcggtagcg
cctgtagctgctccatctcagccgactcaggcactggggagccgcagtgaaaaacgtgtg
ccgatgacccgtttgcgtaaacgtgtcgcggagcgtttgctcgaagcgaaaaatagtacg
gcgatgttgacgacctttaatgaagtcaacatgaaacccattatggatctgcgcaaacag
tatggcgaagcgttcgaaaaacgtcacggcgtccggcttgggtttatgtcgttttacatc
aaagctgtcgtggaagcgctaaaacgttaccccgaagtgaacgcttcgattgacggtgag
gatgtggtttaccacaactacttcgatgtcagcattgcggtatctacgccacgtggtttg
gtgacaccggtattaaaagatgtcgacctgatgggcatggccgatattgagaagagaatt
aaagaattggccgtcaaaggccgcgacggcaagctgaccgtagaggagctgaccgggggt
aatttcacgattacgaacggcggcgttttcggttctttgatgtctacgccgattattaac
ccgccgcagagcgcgatacttggtatgcatgccatcaaggatcgtccgatggcgattgac
ggtcaggtggtgattctgccgatgatgtatctggctctttcctatgaccaccgtcagatt
gatggacgtgagtcggtcgggttcctggttacagtaaaagaaatgctggaagatccggcg
cgtttgctgctggacgtttag

DBGET integrated database retrieval system