KEGG   Dickeya paradisiaca: Dd703_1145Help
Entry
Dd703_1145        CDS       T00927                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dda  Dickeya paradisiaca
Pathway
dda00020  Citrate cycle (TCA cycle)
dda00310  Lysine degradation
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
Module
dda_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dda_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd703_1145
  Amino acid metabolism
   00310 Lysine degradation
    Dd703_1145
Enzymes [BR:dda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dd703_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Dimerisation
Motif
Other DBs
NCBI-ProteinID: ACS84950
JGI: Dd703_1145
UniProt: C6CCD9
Position
1311847..1313067
Genome map
AA seq 406 aa AA seqDB search
MSSIDILVPDLPESVADATVATWHKQPGDSVQRDEVLVEIETDKVVLEVSAIEAGVLDVI
LEAEGATVTARQVLGRLRPGDNSGKETSAKAQLQESTPAQRHTAGLDEESNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEKHLAGKSAPKAVAPVAAPSQPTQALGSRSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGVRLGFMSFYI
KAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDLMGMADIEKRI
KELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAID
GQVVILPMMYLALSYDHRQIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcatagatattcttgtacctgacctgcctgaatccgtggcggatgctacggtg
gcgacctggcacaaacaaccgggggatagcgtccagcgtgatgaggtactggttgaaatt
gaaactgataaagttgtactagaagtgtctgcgattgaagctggcgtgctagacgtgatt
ctggaagctgagggggcgacggtgacagcgcgccaggtacttgggcgtttacgtccaggc
gataattccggcaaggaaaccagtgctaaagctcagcttcaggagtcaacgccggcccaa
cgtcataccgcgggcctggatgaagaaagtaacgacgcactcagcccggcgattcgacgc
ctgatcgccgagcacgatctggatgctgcggcgattaaggggagtggggtcggtggtcgg
attacccgcgaagatgtagaaaaacatttggcaggcaaaagtgctccgaaggcggtagcg
cctgtagctgctccatctcagccgactcaggcactggggagccgcagtgaaaaacgtgtg
ccgatgacccgtttgcgtaaacgtgtcgcggagcgtttgctcgaagcgaaaaatagtacg
gcgatgttgacgacctttaatgaagtcaacatgaaacccattatggatctgcgcaaacag
tatggcgaagcgttcgaaaaacgtcacggcgtccggcttgggtttatgtcgttttacatc
aaagctgtcgtggaagcgctaaaacgttaccccgaagtgaacgcttcgattgacggtgag
gatgtggtttaccacaactacttcgatgtcagcattgcggtatctacgccacgtggtttg
gtgacaccggtattaaaagatgtcgacctgatgggcatggccgatattgagaagagaatt
aaagaattggccgtcaaaggccgcgacggcaagctgaccgtagaggagctgaccgggggt
aatttcacgattacgaacggcggcgttttcggttctttgatgtctacgccgattattaac
ccgccgcagagcgcgatacttggtatgcatgccatcaaggatcgtccgatggcgattgac
ggtcaggtggtgattctgccgatgatgtatctggctctttcctatgaccaccgtcagatt
gatggacgtgagtcggtcgggttcctggttacagtaaaagaaatgctggaagatccggcg
cgtttgctgctggacgtttag

DBGET integrated database retrieval system