KEGG   Dickeya paradisiaca: Dd703_1146Help
Entry
Dd703_1146        CDS       T00927                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dda  Dickeya paradisiaca
Pathway
dda00020  Citrate cycle (TCA cycle)
dda00640  Propanoate metabolism
dda00660  C5-Branched dibasic acid metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
Module
dda_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dda_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd703_1146
   00640 Propanoate metabolism
    Dd703_1146
   00660 C5-Branched dibasic acid metabolism
    Dd703_1146
Enzymes [BR:dda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dd703_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACS84951
JGI: Dd703_1146
UniProt: C6CCE0
Position
1313200..1314366
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPAGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKSGGV
KVVNSKEDIRAFAEKWLGKHLVTYQTDANGQPVNQILVESATDIDKELYLGAVVDRGSRR
VVFMASTEGGVEIEKVAEETPHLIHKMALDPLAGPQPYQGRELAFKLGLSGKQIAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLVCLDGKLGVDGNALFRQPELREMRDASQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDDKVNAVLVNIFGGIVRCDLIADGIIGAVSEVGVSVPVVVRLEGNNAELGAQK
LADSGLNIIAATSLTDAAQQVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggcaaaacagctttttgctcggtatggtttgccggctcca
gccggttacgcctgcacaacgccgcgtgaagcggaagaggccgcatccaaaatcggcgca
gggccgtgggtggtaaaatgccaggtacacgcgggcggacgcggcaagtccggtggcgtg
aaagtcgtcaacagcaaggaagacatccgcgcctttgctgagaaatggctgggtaagcat
ttagtgacctatcagactgacgcaaacggtcagccggtcaaccagattctggtggaaagc
gctacagatattgataaagaactttatctgggcgcggttgtggatcgtggtagccgccgg
gttgtttttatggcgtcgacggaaggcggcgtggaaatcgaaaaggttgcggaagaaacg
ccccacctgattcacaaaatggcattggatccgctagcagggcctcaaccttatcagggc
cgcgaactggcgttcaagttggggttaagcggtaagcagattgcacaattcaccaaaata
ttcatgggattggcgacgttgtttctggagcgagatctcgcattggtcgaaatcaacccc
ttggtgatcaccaaacaaggtgatctggtctgtctggacggcaagctgggtgttgacggc
aacgcactgttccgccagccggaactgcgtgaaatgcgtgatgcttcccaggaagacgcg
cgtgaggcacatgctgctcagtgggaactgaactatgtcgcgctggacggcaatatcggt
tgtatggtcaatggtgccggtttggcgatgggaaccatggacatcgtgaaactgcatggc
ggcgcaccggctaactttctcgatgtcggcggcggcgcgacgaaagagcgcgtcaccgaa
gcgtttaagatcattttgtctgatgacaaggtgaacgcggttctggttaatattttcggc
ggtattgtacggtgtgacctgattgccgacggtatcatcggtgcggtgtcggaagttggc
gtcagcgttcccgtggttgtccgtcttgaaggaaataatgccgaattgggcgcacagaag
ttggcagatagcggcctgaacattattgccgcgaccagcctgacggatgcagctcagcaa
gtggttgccgccgcggagggtaaataa

DBGET integrated database retrieval system