KEGG   Dickeya paradisiaca: Dd703_1170Help
Entry
Dd703_1170        CDS       T00927                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dda  Dickeya paradisiaca
Pathway
dda00010  Glycolysis / Gluconeogenesis
dda00052  Galactose metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
Module
dda_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_1170
   00052 Galactose metabolism
    Dd703_1170
Enzymes [BR:dda01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dd703_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACS84974
JGI: Dd703_1170
UniProt: C6CCT3
Position
complement(1337316..1338368)
Genome map
AA seq 350 aa AA seqDB search
MSSDLTETTELAPDGRPFQLVTLRNRAGMHVTLMDWGATWLSCQIPLSDTETREILLGCA
PVQYPQQNAYLGASVGRYANRIARATLHYDGNDIALAANQGRHQLHGGPDGFHARRWQIL
QRDERQVVYQLHSPDGDQGFPGALTAQVRYQLTEQNALEIDYQAVVDQPCPVCLTNHAYF
NLDGRRSDARQHQLQIMADYYLPVDSEGIPLNGLKAVQGGSFDFRHPKTLLKDFMIDRDQ
QAVSGYDHAFLLHRTCGSSESPAARLWSADGRLELAVYTSAPALQLYSGNFLTGTPTREG
GRYPNFAGIALESEFLPDSPHHPDWPQPDCWLKPGKRYHSLTTYALSIHP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtgaccttaccgaaactaccgagctagcgccggatgggcggccttttcagctc
gtcacgctgcgcaaccgcgcgggtatgcacgtcacactgatggactggggagccacctgg
ctctcctgccaaatccccttgtccgacacggaaacacgagagatcctgctcggttgtgcg
ccggtgcagtatccacagcaaaatgcctacctcggcgcgtccgtcggccgttatgccaac
cgtattgcccgcgccacgctgcactacgacggcaatgacattgcactcgccgccaatcag
ggtcgtcaccaactgcacggcggcccggacggttttcatgcccgccgctggcaaatactg
caacgggatgagcgacaagtggtctatcagcttcattcaccggacggcgatcagggattc
cccggcgcgttgacggcgcaggtgcgctatcaactgaccgagcagaatgcgctggaaatc
gactatcaggcggtggtggatcagccctgcccggtctgtttaaccaaccatgcctatttc
aacctggacggtcgtcgttccgacgcccggcagcaccaactgcaaattatggcggattac
tacctgccggtggatagcgaaggcatcccccttaacggactgaaagcggtacagggcggc
agtttcgacttccgtcatcctaaaacgctgctgaaagattttatgatcgatcgggatcag
caggccgtcagcggctacgatcacgcctttctgttgcaccgcacctgcggctccagcgaa
agcccggcagccaggctgtggtctgccgacggtcggctggaactggcggtgtataccagc
gccccggcgctgcagttgtatagcggcaattttctgaccggcaccccgacgcgggaaggc
ggccgttacccgaatttcgccggcatcgcgctggagagcgagtttctgccggacagcccg
catcaccccgactggccacagcccgattgctggttgaagcccggcaaacgctatcattct
ctcaccacctacgcgctgagcattcatccctga

DBGET integrated database retrieval system