KEGG   Dickeya dadantii Ech703: Dd703_1185Help
Entry
Dd703_1185        CDS       T00927                                 

Definition
pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dda  Dickeya dadantii Ech703
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dd703_1185
Enzymes [BR:dda01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Dd703_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1353527..1354525)
Genome map
AA seq 332 aa AA seqDB search
MKTLADFERVTLGFFPTPLESLPRLGDDLGIALSIKRDDYTGFGGGGNKVRKLEYLMADA
CRRQVNVVITTGGHQSNHARMVAAAARKYGMKPVLVLRGHAPDAYQGNLLLDRLFGAELE
FLDPDAYFTQIDGAMQAHADAASARGEKPLIIPLGGATPLGALGYVRAVEEMAAQLSERG
ENPPDYLIAPCGSGGTLAGLYVGARRYWPQTRIIGISVSAKSEWFQARIAAMAQACADLL
EWGQRWQPEEIQVADDYVGAAYGVPSPGGIDAIYQAARREGVLLDPVYTGKAMHGLFALV
AQQRIQPGSRVVFIHCGGSPALYPFAQRLLEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctggctgattttgaacgtgtcacgttgggatttttccccaccccactggag
tcgctaccgcggctgggcgacgatctcggcattgcactgtcgattaaacgcgacgactac
accggattcggcggcggcggcaacaaagtacgcaagctggaatacctgatggccgacgcc
tgccgccgacaggtgaacgtggtgatcaccaccggcggccatcagtccaaccatgcccgc
atggtggcggccgcagcgcgtaaatacggcatgaaaccggtactggtgctacgcggccat
gcgcccgacgcctaccagggcaatctgctgctcgataggttgttcggcgcagaactggaa
tttcttgacccggacgcctatttcacccagatcgacggcgccatgcaggcgcacgccgat
gcggcctcggcccgcggtgaaaaaccgctgatcatcccgctgggcggcgcgacgccgctc
ggcgcgctgggttacgtccgagcggttgaagaaatggcggcgcagttgagcgaacgcggc
gagaatccgccggattatctcatcgccccttgtggctccggcggaacgctggcgggcctc
tacgtcggcgcccgtcgctactggccgcagacgcgcatcatcggcatcagcgtcagcgcc
aaatccgaatggtttcaggcgcgcatcgccgccatggcgcaggcatgtgccgatctgctg
gagtggggacagcgctggcagcccgaagagatccaggtcgcggacgactacgtgggcgct
gcctacggcgtgccctcgcccggcggcatcgatgctatctatcaggcggcgcggcgcgaa
ggcgtgctgcttgatccggtctataccggtaaagccatgcatggcctattcgcgctggtg
gcacagcaacgcatccagccgggcagccgggtcgtctttatccactgtggcggctccccc
gcgctgtacccctttgcacaacgcttactggaggcctga

DBGET integrated database retrieval system