KEGG   Dickeya paradisiaca: Dd703_1203Help
Entry
Dd703_1203        CDS       T00927                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dda  Dickeya paradisiaca
Pathway
dda00040  Pentose and glucuronate interconversions
dda00052  Galactose metabolism
dda00500  Starch and sucrose metabolism
dda00520  Amino sugar and nucleotide sugar metabolism
dda01100  Metabolic pathways
dda01130  Biosynthesis of antibiotics
Module
dda_M00362  Nucleotide sugar biosynthesis, prokaryotes
dda_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd703_1203
   00052 Galactose metabolism
    Dd703_1203
   00500 Starch and sucrose metabolism
    Dd703_1203
   00520 Amino sugar and nucleotide sugar metabolism
    Dd703_1203
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dd703_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACS85007
JGI: Dd703_1203
UniProt: C6CCW6
Position
1375388..1376284
Genome map
AA seq 298 aa AA seqDB search
MTTLKAIIPVAGLGMNLLPVTKAIPKEMLPLVDRPVIEKIVNECANAGIKEIVLVTHASK
NAIENHFDTSFELESLLEERAKRQLLAEVKSICPPGVTIMNVRQGQTLGLGHAVSCARPI
VGDAPFVVVLPDVVMDEYSADQSKDNLAQLISRFEETGHSQVLVKHRPYEVLPEYSIIEC
QSPLTQEGDASAIVSMIEKPELAPVEGSDLSAVGRYVLTAQAWPILEKILPGAWGRIQLT
DAIAELIKTQQVDAVQMAGRSFNCGRKMGYVQAFVSYGLRNAELGEDFKANIKQLLAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattaaaagcgattatccccgttgctggtttggggatgaatttattgccggtc
actaaagcaattccgaaagaaatgctgccgttagtggatcgaccggttattgaaaagatc
gtcaacgagtgcgccaacgccggtatcaaagaaatcgtgttggtgactcatgcctccaaa
aatgccatcgaaaaccattttgatacctcctttgagctggaatccctgctggaagagcgt
gctaaacgccaattgctggcggaagtgaaatcgatttgtcctcctggcgtcaccattatg
aacgttcgccaggggcaaacgttggggttggggcatgcggtttcttgtgcgcggccgatc
gttggcgatgctccgtttgtggtggtgttgccggacgtcgtgatggatgagtattccgct
gatcagtcaaaagataatctggcccagctgatttcacgttttgaagagactggtcacagc
caggtgttggtcaaacaccggccatatgaagtgctgccggagtattccatcattgaatgt
cagtctcctctaacacaggaaggtgacgcatccgcgattgtttccatgattgaaaaacca
gaactggccccggttgaagggtctgatctgtctgcggtagggcgttatgtgctgacggcg
caagcctggccgattctggaaaaaatcctgccgggagcatgggggcgtattcaacttacc
gatgctatcgccgagctgatcaaaactcagcaggtggatgcggtgcaaatggccgggcgc
agtttcaactgcggcagaaagatgggctatgttcaggcgtttgtttcgtatggcctgcgt
aatgccgaactgggtgaagattttaaagccaatatcaaacagttgttggcaaaataa

DBGET integrated database retrieval system