KEGG   Dickeya paradisiaca: Dd703_1301Help
Entry
Dd703_1301        CDS       T00927                                 

Definition
(GenBank) pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family
  KO
K17950  L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
dda  Dickeya paradisiaca
Pathway
dda00270  Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dd703_1301
Enzymes [BR:dda01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     Dd703_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACS85103
JGI: Dd703_1301
UniProt: C6CDI6
Position
1487509..1488519
Genome map
AA seq 336 aa AA seqDB search
MHLARFPRLSLGHFPTPLEPLPALSAYLGGPTLYIKRDDATGLATGGNKTRKLEFLLAEA
VAQHADIILTQGATQSNHVRQTIAGAARLGLQTHYFLERRVDDFGEEYQRSGNVLLDDLL
GGERVDHLPAGADMPLAMEAHAEQLRAQGRRPYVIPGGGSNATGALGYVAAAEELLYQSS
QQRLRIDHIVHATGSTGTQAGLVAGLAATHSGIPVLGISVRAPREKQEENVWLLAQRVWQ
KLALKGEVPREAVRVNSDYVGQGYGIPTAATLEALQLLARLEGILLDPVYSGKAMAGLID
LIRKGEFGKQDNVLFVHTGGAAGLFGYRQWFERQAE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcatctggcgcgttttccccgtttgtcgctgggacattttcccacgccgttggagccg
ttaccggcgctgtccgcctacctcggcggcccgacactgtatatcaagcgcgacgacgcc
accgggttggcgaccggcggcaataaaacccgcaagctggagtttctgctggcggaggcg
gtagcgcagcatgcggatatcattctgacgcagggagccacccagtccaaccatgtgcgg
cagaccattgccggggcggcgcgtctcgggttgcagacgcactattttttggagcggcgg
gtcgatgatttcggtgaggagtaccagcgctcgggcaacgtgctgctggatgatttgctg
ggtggcgaacgggtggatcacctgccagcgggggcggatatgccactggcgatggaagcg
cacgccgagcaactgcgcgcgcagggccgccgtccgtatgtgatccccggcggcggatcc
aatgccacgggggcgctgggatacgtggcggcggcggaagagctgctataccagtcgagc
caacaacggttgcgtatcgaccatatcgtgcatgctaccggcagcaccggcactcaggcc
gggctggtagccgggttggccgctacccacagcggtattccggtgctgggcatcagcgtg
cgagcccctcgggagaagcaagaagagaatgtttggctgttggcgcagcgcgtatggcag
aagctggcgctgaagggcgaggtgccgcgcgaggcggtgcgcgtcaacagcgattacgtt
gggcaaggttacggcatccccaccgccgcgacgttggaggcgttgcaactgctggcccgg
ctggaaggtattctgcttgacccggtttattccggtaaagcgatggccgggcttattgat
ctgatccgcaaaggcgaattcggcaaacaggataacgtactgtttgtgcacaccggcggc
gcggcgggattgttcggctatcgtcaatggtttgaacggcaggccgagtga

DBGET integrated database retrieval system