KEGG   Dickeya dadantii Ech703: Dd703_1301Help
Entry
Dd703_1301        CDS       T00927                                 

Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
dda  Dickeya dadantii Ech703
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dda00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1487509..1488519
Genome map
AA seq 336 aa AA seqDB search
MHLARFPRLSLGHFPTPLEPLPALSAYLGGPTLYIKRDDATGLATGGNKTRKLEFLLAEA
VAQHADIILTQGATQSNHVRQTIAGAARLGLQTHYFLERRVDDFGEEYQRSGNVLLDDLL
GGERVDHLPAGADMPLAMEAHAEQLRAQGRRPYVIPGGGSNATGALGYVAAAEELLYQSS
QQRLRIDHIVHATGSTGTQAGLVAGLAATHSGIPVLGISVRAPREKQEENVWLLAQRVWQ
KLALKGEVPREAVRVNSDYVGQGYGIPTAATLEALQLLARLEGILLDPVYSGKAMAGLID
LIRKGEFGKQDNVLFVHTGGAAGLFGYRQWFERQAE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcatctggcgcgttttccccgtttgtcgctgggacattttcccacgccgttggagccg
ttaccggcgctgtccgcctacctcggcggcccgacactgtatatcaagcgcgacgacgcc
accgggttggcgaccggcggcaataaaacccgcaagctggagtttctgctggcggaggcg
gtagcgcagcatgcggatatcattctgacgcagggagccacccagtccaaccatgtgcgg
cagaccattgccggggcggcgcgtctcgggttgcagacgcactattttttggagcggcgg
gtcgatgatttcggtgaggagtaccagcgctcgggcaacgtgctgctggatgatttgctg
ggtggcgaacgggtggatcacctgccagcgggggcggatatgccactggcgatggaagcg
cacgccgagcaactgcgcgcgcagggccgccgtccgtatgtgatccccggcggcggatcc
aatgccacgggggcgctgggatacgtggcggcggcggaagagctgctataccagtcgagc
caacaacggttgcgtatcgaccatatcgtgcatgctaccggcagcaccggcactcaggcc
gggctggtagccgggttggccgctacccacagcggtattccggtgctgggcatcagcgtg
cgagcccctcgggagaagcaagaagagaatgtttggctgttggcgcagcgcgtatggcag
aagctggcgctgaagggcgaggtgccgcgcgaggcggtgcgcgtcaacagcgattacgtt
gggcaaggttacggcatccccaccgccgcgacgttggaggcgttgcaactgctggcccgg
ctggaaggtattctgcttgacccggtttattccggtaaagcgatggccgggcttattgat
ctgatccgcaaaggcgaattcggcaaacaggataacgtactgtttgtgcacaccggcggc
gcggcgggattgttcggctatcgtcaatggtttgaacggcaggccgagtga

DBGET integrated database retrieval system