KEGG   Dickeya dadantii Ech703: Dd703_1606Help
Entry
Dd703_1606        CDS       T00927                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dda  Dickeya dadantii Ech703
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dd703_1606
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Dd703_1606
Enzymes [BR:dda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dd703_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1890595..1891641
Genome map
AA seq 348 aa AA seqDB search
MKNQEVFVGPLMLDVAGYALDAEDRDVLEHPLVGGVILFSRNFHDADQLAELVRQIREAS
RERLVVAVDQEGGRVQRFRQGFTALPAAQSFAALNDLPQAQQLAEEAGWVMAAEMISMDI
DISFAPVLDVGHQSAAIGDRAFHDEPDTLLAVAGGFIQGMRQAGMKATGKHFPGHGAVSA
DSHQETPRDDRPLALIQKRDMHIFRALNDANLLDAVMPAHVIYSDADPRPASGSPYWLKQ
VLRQSLGFDGIIFSDDLSMEGAAVMGNYVDRAQASLDAGCDMILVCNQRQGAISVLDNLP
LINVDRLARLYHQGRFTRRELLDSSRWKQSSQALTTLSERWLAYKATR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaagaggtgtttgtgggcccattaatgttagatgtcgccggctacgcgctg
gatgcggaagatcgggacgtgctggaacatccgctggtcgggggcgtgatcctgttcagc
cgtaattttcacgatgccgatcaattagccgagttggtacggcagattcgtgaggcctcc
cgggagcggttggtggtagcggtggatcaggagggcggacgggtacaacgtttccgccag
gggtttaccgctttaccggccgcgcagtcttttgccgcacttaacgatctgccgcaggcg
cagcaattggcggaagaggcggggtgggtgatggcggccgagatgatcagcatggatatc
gacatcagtttcgcaccggtgttggatgttggacatcagagcgcggccattggcgatcgt
gcgtttcacgatgagcctgatacgttgctggcggtggccggtggttttattcagggaatg
cgtcaggctgggatgaaagccaccggtaaacacttccccggtcacggcgcggtcagtgcg
gattcccaccaagagacgccgagggatgatcgcccgttggcgcttatccagaaacgggat
atgcacattttccgcgcgttgaacgacgccaatctgctggatgccgtcatgccggctcac
gtcatttattccgacgccgatccacgcccggccagcggctcgccatactggctgaagcag
gtattgcgacaatcgctgggttttgacggcatcattttttccgacgatctttccatggaa
ggcgcggcggtgatgggaaattatgtggatcgcgcgcaggcgtcgctggatgccggatgc
gacatgattctggtgtgtaatcaacggcaaggagctatcagcgtgctggataacctgccg
ttgatcaatgtagaccgtctggcgcggctttatcatcagggcaggtttacccgtcgtgaa
ttgcttgattcatcacgctggaagcagtcgagtcaagcattgactacactcagtgaacgt
tggctggcctataaggccacgcgctga

DBGET integrated database retrieval system