KEGG   Dickeya dadantii Ech703: Dd703_1626Help
Entry
Dd703_1626        CDS       T00927                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dd703_1626
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dd703_1626
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dd703_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1915438..1915989
Genome map
AA seq 183 aa AA seqDB search
MSNDLYAIPLQTIDGRATTLDSWQNNVMLIVNVASQCGLTKQYEALENLYETYRDRGFVV
LGFPSNEFAGQEPGSNEEILAFCRGTFGVQFPMFGKIDVNGAGRHPLYQALIAAQPEAVR
PAGSEFYERRVSRGQAPAHREDILWNFEKFLINRRGKVIARFSPDMTPDDGVLVKVIEQV
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgatttgtacgcaattcccctgcaaaccatcgatggccgcgccacgacgctg
gatagctggcagaacaatgtcatgctgatcgtcaatgtggcttcccagtgcggactgacc
aaacagtatgaagcgctggaaaatctgtatgaaacctatcgcgatcgcggttttgtggtg
ctgggtttcccctccaacgagttcgccggtcaggaaccgggcagcaatgaggaaatcctg
gcgttctgtcggggcactttcggggtgcagtttcccatgttcggcaagatcgacgtcaat
ggcgccggccgccatccgctgtatcaggcgctgatcgcggcgcagccggaagcggttcgt
cctgccggcagcgagttttatgaacgccgggtgagccgcgggcaggcgccagcgcaccgg
gaagatattctgtggaatttcgagaaattccttatcaatcgacgcggcaaggtgatcgcg
cgtttttcgccggacatgacgccggacgacggtgtgttggtgaaagtgattgagcaggtg
ctggcacaataa

DBGET integrated database retrieval system