KEGG   Dickeya dadantii Ech703: Dd703_1668Help
Entry
Dd703_1668        CDS       T00927                                 

Definition
glycoside hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dda00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1969468..1970865
Genome map
AA seq 465 aa AA seqDB search
MSSIFPEHFLWGGAIAANQVEGAYLDDGKGLSTSDLQPQGIFGDIKARHSGDFSLKDVAI
DFYHRYPQDIALFAEMGFSCLRVSIAWTRIFPQGDETQPNEAGLAFYDRLFDELARYGIQ
PLVTLSHYEMPYGLVQNHGGWGNRQTIDCFERYARTVFQRYQHKVKLWLTFNEINMSLHE
PFTGVGLARGSELPAIYQAIHHQLVASARAVKACHDIIPDARIGNMMLGALLYPLTCKPQ
DVMESLHQNREWLFFGDVQVRGAYPAYMRRFFKEKNITLDITEQDRLDLQSTVDFISFSY
YMTGCVSADEAEVEKARANILNMVPNPYLESSEWGWQIDPEGLRYLLNFLYDRYQKPLFI
VENGLGARDNIEADGSINDDYRIKYLNDHLVQVGEAIEDGVDVLGYTCWGPIDLVSASKA
EISKRYGFIYVDRDDQGNGSLERKRKKSFFWYQSVISSKGDMLKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtattttccctgaacatttcctgtggggcggcgctatcgccgccaatcaggtc
gaaggtgcctatctggatgatggaaaagggctttccacgtctgatttgcagccccagggc
atttttggcgatatcaaggcgcgtcattccggggatttttcccttaaggatgtcgcaatc
gatttttatcaccgctatccgcaggatattgcgttgtttgcggaaatgggtttttcctgc
ctgcgtgtgtccatcgcctggacacgtattttcccacagggggatgaaacacaacccaat
gaggcgggactggccttttatgatcgtctgttcgacgagctagccagatacggtattcag
ccgctggtgacgctatcgcattatgaaatgccttacggtctggtgcagaaccacggcggc
tggggcaaccgccagaccattgactgttttgaacgctatgcgcgtactgtttttcaacgt
tatcagcacaaggtgaaactgtggctgacgttcaatgaaatcaatatgtccctgcatgag
ccctttaccggtgtcggactggcgcggggcagtgagctgccggccatttatcaggcgatt
caccatcagctggtcgccagcgcccgggcggttaaggcgtgtcacgatattatccccgat
gcccgtatcggcaacatgatgctgggcgcattgctctatccgttgacctgtaaaccgcag
gatgtcatggaaagcctgcatcagaaccgggaatggctgtttttcggcgatgttcaggtg
cggggcgcttatcctgcatatatgcgtcgttttttcaaagaaaaaaacatcacgctggat
attaccgagcaggatcgtcttgatttgcaatcgaccgttgatttcatctctttcagctat
tacatgacggggtgcgttagcgccgatgaagccgaagtggaaaaagcgcgcgccaatata
ttaaacatggtaccgaacccttatttagaaagttcggagtggggatggcaaatcgatccg
gaaggattacggtatttattaaatttcctgtatgaccgttaccaaaaaccattatttatt
gtcgagaatggtcttggcgccagagataatattgaagcggacggttcaattaatgatgac
tatcgcattaaatacctgaatgatcatctggtgcaggtcggcgaagcgattgaggatggc
gtcgatgtattgggatatacctgttgggggccgatagacctggtcagcgcatccaaagcg
gaaatatcgaagcgctatgggtttatctatgttgatcgtgacgatcagggtaatggtagt
ttggagcggaagcggaagaaaagctttttctggtatcaatcggttatttccagtaaaggt
gacatgctcaaaaaataa

DBGET integrated database retrieval system