KEGG   Dickeya paradisiaca: Dd703_1821Help
Entry
Dd703_1821        CDS       T00927                                 

Definition
(GenBank) glycoside hydrolase family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
dda  Dickeya paradisiaca
Pathway
dda00010  Glycolysis / Gluconeogenesis
dda00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_1821
   00500 Starch and sucrose metabolism
    Dd703_1821
Enzymes [BR:dda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Dd703_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ACS85617
JGI: Dd703_1821
UniProt: C6C507
Position
complement(2170338..2171768)
Genome map
AA seq 476 aa AA seqDB search
MSASTFPDGFLWGGALAANQSEGAYLEGGKGLTTVDMIPHGPNRLPVKLGLEKRVALRND
EFYPSHQAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDDAAPNPAGIAFYRDVF
NECRKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKMVDFFTRYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLVFEAGENQDQVKYQAAHHELIASALATRIAHEVNPVNQVGCMLA
GGNFYPWSCKPEDVWAALEKDRENLFFIDVQARGAYPSYSARVFREKGVHIDMLDGDAEI
LKNTVDFVSFSYYASRCASADMNEHNSSAANIVKSLTNPHIQRSEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGARDDINVDGKIEDDYRISYLREHIRAMADAIADGVPVMGYTT
WGCIDLVAASTGEMSKRYGFVYVDRDDHGNGTLARRKKKSFGWYRKVIASNGRDLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatcgacattccctgacgggtttctatgggggggcgccttggcggcaaaccag
tcggaaggcgcctatctggagggcggcaaggggctgaccaccgtcgatatgatcccgcac
ggcccgaaccggctgccggtcaaactggggttggaaaaacgtgttgcgctgcgtaacgac
gagttctatcccagccaccaggcgatcgatttctaccaccgttacaaagaagacatcgcg
ctgatggcggagatgggcttcaccgtgttccgcacctccatcgcctggagccgtctttac
ccaaacggcgacgacgcggcgccgaacccggcgggcattgcgttttaccgcgatgtattc
aatgaatgccgtaaatacggcatcgaaccgctggtgacgctgtgccatttcgacgtgccg
atgcatctggtgacggagtacggctcatggcgcaaccgtaaaatggtggactttttcacc
cgctacgcccgtacctgttttgaagccttcgatgggttggtgaaatactggctgacgttc
aacgagatcaacattctgctgcacagccccttctccggcgccggtttggtcttcgaagcg
ggagagaatcaggaccaggtgaaatatcaggcagcgcaccatgagctgatcgccagtgcg
ctggcgacccgaattgcgcacgaggtcaatcccgtcaatcaggtgggctgtatgctggca
ggcggtaacttttacccctggtcgtgcaagccggaagacgtgtgggcggcactggagaaa
gatcgcgagaacctgttctttatcgatgtgcaggcgcgcggcgcttatccctcttactcg
gcgcgggtgttccgtgagaaaggcgtccatatcgacatgctggacggcgacgccgagatc
ctgaaaaacaccgtcgacttcgtctccttcagctactacgcctcgcgctgtgcctcggcc
gacatgaacgagcacaacagcagcgccgccaatatcgtcaaatcgctgaccaacccgcat
attcaacgcagcgaatggggttggggcatcgacccgttggggctgcgcatcaccatgaac
atgatgtacgaccgctaccagaagccgctgtttttagtagagaacgggctcggcgcgcgg
gatgatatcaacgtcgacggcaagattgaggacgattaccgcatcagctacctgcgtgaa
cacatccgcgccatggccgatgcgattgcagacggcgtcccggtgatgggctacaccacc
tggggctgtattgacctggtggccgcctccaccggcgagatgagcaaacgctacgggttc
gtctacgtcgatcgggacgatcatggcaacggcacgttggcgcgtcggaagaaaaaatcg
ttcggctggtaccggaaggtgatcgccagcaacggccgggatctggactga

DBGET integrated database retrieval system