KEGG   Dickeya paradisiaca: Dd703_1853Help
Entry
Dd703_1853        CDS       T00927                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dda  Dickeya paradisiaca
Pathway
dda00900  Terpenoid backbone biosynthesis
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dd703_1853
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dd703_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACS85646
JGI: Dd703_1853
UniProt: C6C536
Position
complement(2204781..2205653)
Genome map
AA seq 290 aa AA seqDB search
MQATITQWPSPAKLNLFLYVTGRRADGYHNLQTLFQFLEYGDTLTITPRPDCRILLHTPI
AGVPDEQNLIVRAASLLQVHCQQHHLPYAGADIAIEKRLPMGGGLGGGSSNAATVLLALN
YLWNSRLSAKALAELGLALGADVPVFIHGHAAFAEGVGEVLTPVSPPEKWYLVIHPGVHI
STPLIFKDQDLKRNTPVMPLDRLLTQPFRNDCETVVRKRFRKVEELLLWLLEYAPARLTG
TGACVFAEFDTESAARQVLDRVPERMTGFVARGANISPLQQLLSGLSEGA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgacaatcacgcaatggccgtccccggctaagctgaatctgttcctgtacgtc
accgggcgtcgcgccgacggttatcacaatctgcaaacactgttccaatttctggagtat
ggcgacacgctgacgatcacccccagaccggattgtcgcatccttttgcacacccccatt
gccggcgtaccggatgaacaaaacctgattgtccgcgcggccagcctgttacaggttcat
tgtcagcagcaccatcttccttacgccggagcagatatcgccatcgaaaaaagactgccg
atgggtggcggtttaggcggcggctcatcaaacgcagccaccgtattactggcgctgaat
tatttgtggaacagtaggttatccgccaaagcattggcggagctggggctggcgttaggt
gcggatgtccctgttttcattcatgggcatgctgcatttgccgagggcgtgggggaggtt
ctgacccccgtatcgccgccggaaaaatggtatctggttatacatcccggcgtacacata
tcaacaccattaatatttaaagatcaggatcttaaacgtaacacgccggttatgccgctg
gatcgcctactcacacaacctttccgtaatgattgcgaaactgtagtaagaaaacgtttt
cgtaaggttgaagagctacttttatggctgttagaatacgcaccggcgcgcctgactggc
accggcgcttgcgtgtttgctgaattcgacaccgagtccgccgcacgtcaggtgctagac
cgggttccggaaagaatgaccgggtttgttgcccgcggcgcgaatatctccccgttgcaa
caactgctttccggcctatcagaaggcgcatga

DBGET integrated database retrieval system