KEGG   Dickeya dadantii Ech703: Dd703_1886Help
Entry
Dd703_1886        CDS       T00927                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dda  Dickeya dadantii Ech703
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd703_1886
Enzymes [BR:dda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Dd703_1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2246680..2248035
Genome map
AA seq 451 aa AA seqDB search
MSLLDLNKTTFLSREKIISHRHFSLATVCFGLVMTCFSGTVMASVEPLSVNGNKIYAGEQ
VKSFAGNSLFWSNNGWGGEKFYTAETVARLKSEWGASIVRAAMGVQESGGYLQDPSGNKA
KVEKVVDAAIANDMYVIIDWHSHHAEDNQNEAISFFQEMAKKYGDKPNIIYEIYNEPLQV
SWGNTIKPYAEAVISAIRAIDSDNLIIVGTPTWSQDVDEASLNPISGTNIAYTLHFYAGT
HGESLRNKALKALNNGIALFVTEWGAVNADGNGGVNASSVDTWVTFMRDNNISNANWALN
DKDEGASTYYPDSLTLTESGKKVKEIIQNWPYNTGTSTSSTATGSSSSGDAETSSSSCSS
ASASTSSSDTGTSASTTTTTADSTATTATTVSCSNVNVYPNWVSKDWSGGEYTHNNAGEQ
MVYQGTLYSANWYTASVPGSDGSWTLVGTCG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgcttgatttaaataaaactacttttctcagtcgtgaaaaaattatttcccat
agacatttttccctcgccactgtctgtttcggcttagtgatgacgtgtttttccggcaca
gtgatggctagcgtcgagcctttatctgtcaatgggaataaaatctatgcgggagagcag
gttaagagttttgcaggaaacagtctgttctggagcaataacggttggggtggtgagaaa
ttctataccgcagaaactgtcgccaggctgaaaagcgagtggggcgccagtattgtccgt
gcagccatgggcgttcaggaaagcggtggttatttgcaggatccttctggcaacaaggcg
aaagtagaaaaagtagtcgatgctgcaattgccaacgatatgtatgtcattatcgactgg
cattcgcatcatgcagaagataatcaaaatgaagccattagtttctttcaggaaatggcg
aaaaaatatggcgataaacccaacattatttatgaaatttataatgagccgctgcaagtt
tcgtgggggaataccataaagccttatgcggaagccgttatttccgctattcgtgctatt
gactcagacaatttgatcatcgtcgggacaccgacctggtcgcaggatgtcgatgaggct
tcgctgaacccgattagcggcaccaatatcgcttatacattgcacttttatgcgggaact
catggcgaatcattacggaacaaagcactgaaggcgctgaataatggcattgcgctgttt
gtcaccgagtggggcgcggtcaacgcagatggtaacggtggtgtgaacgccagttcggtc
gacacctgggtgacatttatgcgcgataacaacatcagcaacgccaactgggcgttgaat
gataaagatgaaggggcgtcgacatattatcccgactcgctgaccctgaccgagtccggc
aaaaaggtgaaggaaattattcagaactggccttataacaccggaaccagtaccagcagt
accgcaacagggagctcttcatccggggatgcagagacatccagcagctcatgcagttca
gcgagcgccagcacaagttccagcgataccggaacctcggcttcgaccacaaccacaact
gccgacagtacggcgacaacggcaactacggtcagttgcagtaatgtcaacgtttacccc
aattgggtcagtaaggattggtcaggcggtgaatatacgcataacaatgcaggtgaacag
atggtctaccaggggacactgtacagcgctaactggtacaccgcctcggtaccgggcagt
gacggttcctggacgttggtcggtacttgtgggtaa

DBGET integrated database retrieval system