KEGG   Dickeya dadantii Ech703: Dd703_1935Help
Entry
Dd703_1935        CDS       T00927                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
dda  Dickeya dadantii Ech703
Pathway
dda00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01130  Biosynthesis of antibiotics
dda01230  Biosynthesis of amino acids
Module
dda_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd703_1935
Enzymes [BR:dda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dd703_1935
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Dd703_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ACS85725
JGI: Dd703_1935
UniProt: C6C5T4
Position
2302342..2303727
Genome map
AA seq 461 aa AA seqDB search
MQETVLTRIVRDKAQWLAERQQKQPLESIQSQIVPSTRNFYQALRQTSPAFILECKKASP
SKGLIRADFDPVAIARFYQDYASAISVLTDEKYFQGDFAFLPKVSAAVPQPVLCKDFIIS
PYQIYLARYYQADAILLMLSVLDDNSYRQLAAVAHSLNMGILTEVSNEEELARAIALEAR
VVGINNRDLRDLSIDLNRTRTLAPQLPADVTVISESGISRYAQIQALSQYANGFLIGSSL
MAEDDLTLAVRRVVLGDNKVCGLTRPEDAATAFQAGAVYGGLIFVAGSPRHVTTSQAQSI
MAAAPLRYVGVFRQATVTDIVTTATDLQLDVVQLHGDEDAAFIAALRQQLPERCRIWKAL
SVGAGLPPLTMPHVDRVLLDNAQGGSGRTFDWSLLDGHSLDRVMVAGGLSPENTPAAALL
GAAGLDFNSGVEQQPGVKDPQKIAAVFRTLRQAQRHRTSLI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtactcaccagaatcgtgcgcgataaagcgcaatggctcgccgagcgg
cagcaaaagcagccgctggaaagcattcagtcacagattgttcccagcacgcgcaacttt
tatcaggcgttgcggcagaccagcccggcattcattctggaatgtaaaaaggcgtcgcct
tccaaagggttgatccgtgctgattttgatccggtcgccatcgccaggttttaccaggac
tacgcctccgccatttccgtactgacggacgaaaaatattttcaaggcgatttcgcgttt
ctgcccaaggtcagcgcggctgtgccgcaaccggtactgtgcaaagatttcattatttcg
ccctaccagatttatctggcgcgttattaccaggccgatgccatcctgctgatgctgtcc
gtgctggatgacaatagctaccgccagctcgccgccgtcgcgcacagtctgaacatgggg
attttgacagaggtcagcaacgaggaggaactggcgcgcgccattgcactggaggcgcgt
gtggtgggtatcaataaccgcgatttgcgcgatctctccatcgacctcaaccgcacccgc
acgctggcgccgcagttgcctgccgatgtcaccgtcatcagcgagtccggtatcagccgg
tacgcccagatacaagcactcagtcagtatgcgaacggctttttgatcggcagttccctg
atggcggaagatgacctgacattggcggtacgccgcgtcgtgctgggcgacaacaaggtc
tgcgggctaacgcgcccggaagatgcggcaacggcctttcaggctggcgcggtatacggc
gggctgatttttgtcgccggctcgccacgtcatgtgacaacgtcacaagcgcaaagcatc
atggcggcggcgcctctgcgctacgtcggcgttttccgccaggcgaccgtgaccgacatc
gtcaccaccgccaccgacctgcagcttgacgtcgtacagctgcatggcgacgaagatgcg
gcattcatcgccgcgctgcgtcagcaactgcccgaacggtgccgaatttggaaggcattg
agcgtcggcgccgggttgccgccgttgacgatgccacacgtagatcgcgttctactcgat
aatgcgcaaggcggcagcggacgcactttcgactggtcactgcttgacggccattcgctg
gatcgcgtgatggtggcaggcggtctctcaccggaaaatacgccagcggcagcactgctg
ggtgccgcggggctggattttaattccggcgtagaacagcaacccggagtcaaggatcca
caaaaaatcgccgcagtatttcgcacgttgcgccaggcgcagcggcaccgtacttcactg
atataa

DBGET integrated database retrieval system