KEGG   Dickeya dadantii Ech703: Dd703_1936Help
Entry
Dd703_1936        CDS       T00927                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd703_1936
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd703_1936
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd703_1936
Enzymes [BR:dda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dd703_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2303744..2304934
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALRQLEEAFVSARRDPAFQQEFNDLLKNYAGRPTALTL
CKNLTAGTRTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALMGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
EQAHYLLGTAAGPHPFPTIVREFQRMIGEETKAQVREKEGRLPDAVLACVGGGSNAIGMF
ADFIDEPSVRLIGVEPAGLGIETGQHGAPLKHGRVGIYFGMKSPMMQTEDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALSAFRELSRHEGIIPALESSHALAHALKM
IKAEPEKEQILVVNLSGRGDKDIFTVHDILKSRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacattacttaatccttattttggcgagtttggtggtcagtacgtaccacaaatcctg
atgcccgccctgcgtcagttggaagaagcctttgtcagcgcccgtcgcgacccggcattc
cagcaagaatttaatgacttattgaaaaattatgcgggccgccccaccgcgctcacgctc
tgtaagaacctgaccgccggcacccgcacccggctctacctgaaacgagaagatttgctg
cacggcggcgcgcataaaaccaaccaggtactcggtcaggcgttgctggcgaaacgcatg
ggcaaaaccgaaatcatcgcggaaaccggcgcaggtcagcatggggttgcaacagcactg
gcctgtgcgctgatgggcctgaaatgtcggatttacatgggcgccaaagacgtggagcgg
caatcgccgaacgtgtttcgcatgcggctgatgggggccgaagtcataccggtgcatagc
ggttcttccacattgaaagatgcctgcaacgaagcgttacgcgactggtccggcagctat
gaacaggctcattatctgctgggtactgcggccggcccgcatccctttccaactattgtg
cgtgaattccaacgcatgattggcgaagagaccaaagcgcaagtgcgtgaaaaagaaggc
cggttgccggatgccgtgctggcctgtgtaggcggcggctccaatgccatcggtatgttc
gccgactttatcgatgaaccctccgtgcgtttaataggtgtggaacctgccgggctgggc
attgaaaccggtcaacatggcgcccctttgaagcatggccgggtcggcatctactttggt
atgaagtcgcccatgatgcagacggaagacggccagatcgaagagtcctactccatctcc
gccgggctggatttcccctccgtagggccgcaacacgcttatctgaacagcattggccgg
gcggattatgtatctattaccgacgatgaagcgttgagcgcttttcgcgaactctcccgc
catgaagggatcatccctgcgctggaatcatcgcacgcgctggctcacgcactgaaaatg
attaaggctgaaccggagaaagaacaaattctggtggttaacctgtctggccgcggtgat
aaagacatttttacggttcacgatattctgaaatcccggggagaaatctaa

DBGET integrated database retrieval system