KEGG   Dickeya dadantii Ech703: Dd703_1955Help
Entry
Dd703_1955        CDS       T00927                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dda  Dickeya dadantii Ech703
Pathway
dda00010  Glycolysis / Gluconeogenesis
dda00071  Fatty acid degradation
dda00350  Tyrosine metabolism
dda00620  Pyruvate metabolism
dda00625  Chloroalkane and chloroalkene degradation
dda00626  Naphthalene degradation
dda00650  Butanoate metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_1955
   00620 Pyruvate metabolism
    Dd703_1955
   00650 Butanoate metabolism
    Dd703_1955
  Lipid metabolism
   00071 Fatty acid degradation
    Dd703_1955
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dd703_1955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dd703_1955
   00626 Naphthalene degradation
    Dd703_1955
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dd703_1955
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Dd703_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ACS85745
JGI: Dd703_1955
UniProt: C6C5V4
Position
2323714..2326419
Genome map
AA seq 901 aa AA seqDB search
MAVTNVAELNALVERVKKAQHIFANYTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEQTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADLVLQAAIAAGAPKDIIGWIDEPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSAYDAVRERFATHGGYLLKDKELTAVQGVLLKNGALNAAIVGQP
APRIAELAGLTVPASTKVLIGEVSKTDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQSSRISYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINRKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRFLFNNGYVDQITSVLKQNGLETDVFFEVEADPTLSIVRKGAEQINAFKPDII
IALGGGSPMDAAKIMWVMYEHPDTHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKENLPASYNEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLIANVIRYNANDNPTKQTAFSQYDRPQARRRYAEVAD
HLGLSAPGDRTAQKIEKLLLWLEGMKKELGIPTSIREAGVQEADFLSKVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTFYGRPFTEHAVTEAKAVPAPAPAPAPAPAKAEKKEKKAV
N
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaacaaacgttgctgaactcaacgccttggtcgaacgagtgaagaaagcacag
catatatttgctaattatacgcaggagcaggtagataaaatcttccgtgcggctgcatta
gctgctgctgatgcccgaattccgttggccaaaatggcggtagcggaatccggcatgggg
attatcgaagataaagtgatcaagaatcactttgcttccgaatacatctataacgcttat
aaagacgaacaaacctgcggcgtcttgtctgaggatgatacctttggcaccatcactatc
gcagaacccatcggtattatttgcggtatcgtcccaacgaccaacccaacctccaccgca
atcttcaaggcattgattagccttaaaacccgcaatggcatcatcttctccccacaccct
cgcgcgaaaaacgccacgaacaaagccgcggatctcgtgttacaagccgcgattgccgct
ggcgcgccgaaagacattattggctggatcgacgaaccttccgtggagctttccaaccaa
ttgatgcatcaccccgacatcaacctgatcctggcgacaggcggcccggggatggtgaaa
gcggcatacagctccggtaaaccggccatcggcgtgggcgcgggcaatacaccggtcgtt
atcgatgaaacggcggatatcaaacgcgctgtcgcctccatcctgatgtcgaaaaccttc
gacaatggcgttatctgtgcgtcggaacaatcagtgatcgtggtggattctgcgtatgat
gccgtgcgtgaacgctttgccacccacggtggttatctgctgaaagataaagaactgacc
gccgtacaaggcgtactgttgaaaaacggcgcgctgaatgccgcaatcgtcggtcaaccg
gcgcctcgtattgccgaactggcgggactcaccgttccggccagcaccaaagtgctgatc
ggcgaagtcagcaaaaccgacgaatccgaaccgttcgcccatgaaaaactgtccccgacg
ctggccatgtaccgggccaaagattttgaagacgcagttgaaaaagcggaaaaactggtc
gccatgggcggtatcggccatacctcctgcctttataccgatcaggacaaccagtccagc
cgcatcagctattttggcgataagatgaagaccgcgcgtattttgatcaacaccccggca
tcgcaaggcggtatcggcgatctgtacaacttcaaactggccccttccctgacgctgggt
tgcggctcttggggcggtaactccatttcggaaaacgtcgggccgaaacacttgatcaac
cgtaaaaccgtagccaaacgggcggaaaatatgttgtggcacaagcttcccaaatcgatc
tacttccgccgcggctcattaccgattgcgctggaagaagtcgccagcgatggcgccaaa
cgtgctttcatcgtcactgaccgtttcctgtttaataacggctatgttgatcagatcact
tccgtactgaaacaaaacggcctggaaacagacgtgttcttcgaagtagaggcggatccg
acactcagcatcgtgcgcaaaggcgccgaacaaattaatgcgttcaaaccggacatcatt
atcgcactgggtggtggttccccaatggatgccgccaagatcatgtgggtcatgtacgaa
cacccggatactcacttcgaagagctggctttgcgcttcatggatatccgcaagcgtatc
tataaattcccgaaaatgggcgtcaaggcgaagatgatcgccattaccacgacatccggc
accggttcagaagtcacgccattcgccgtagtgaccgatgacgccaccggacagaaatat
ccattggccgactatgcgctgacacccgatatggctatcgtcgatgccaatctggtaatg
aacatgccgaaatccctgtgcgcattcggtggtctcgatgctgttacccatgcattggaa
gcctacgtctccgtactggccaatgaatactctgacggccaggcgttgcaggcgttgaaa
ctgctgaaagaaaacctgccggcaagctataacgagggtgccaagaacccggtggcacgc
gagcgtgttcacaacgccgccacgatagccggtatcgcgtttgccaacgccttcctcggc
gtctgtcactccatggctcacaaactgggttccgagtttcatattccgcacgggctggcc
aatgccctgctaatcgctaacgtgatccgttataacgccaacgacaacccgaccaagcag
acggcattcagccagtatgaccgtcctcaggcacgccgtcgttatgccgaagtggcagac
catttgggcttgagcgctcctggcgatcgtaccgcgcagaaaatcgaaaaattgctgttg
tggctggaaggcatgaagaaggaactgggtatccccacctctattcgtgaggccggcgtg
caggaggcggatttcctgtccaaggtggacaaactgtctgaagatgcgttcgacgatcag
tgtaccggcgccaacccgcgttatccgctgatctcagaattgaagcagattctgttggac
acattctacggccgtccgtttaccgagcatgctgtcactgaagccaaagcggtacctgca
ccggcaccggcaccggcaccggcaccggcaaaagcagaaaagaaagaaaaaaaagccgtt
aattaa

DBGET integrated database retrieval system