KEGG   Dickeya dadantii Ech703: Dd703_1958Help
Entry
Dd703_1958        CDS       T00927                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dda  Dickeya dadantii Ech703
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd703_1958
   00052 Galactose metabolism
    Dd703_1958
   00500 Starch and sucrose metabolism
    Dd703_1958
   00520 Amino sugar and nucleotide sugar metabolism
    Dd703_1958
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dd703_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2328924..2329835)
Genome map
AA seq 303 aa AA seqDB search
MSTINKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVQRQLLQEVQAICPEHVTIMQVRQGLAKGLGHAVL
CAHPLIGDEPVAVVLPDVIIDEYASDLKKDNLSEMLQRFYSTGHSQIMVEPVENVSSYGV
VDCKGVELKPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWDLLKKTQPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMTAFVEYAMRHDVLGADFSQWLSDAIED
KVN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactatcaataaaaaagtaaaaaaagcggtcattccggtggcagggctgggaaca
cgtatgttacccgctactaaagccattcccaaagaaatgctgccattggtcgataaaccg
ctgattcagtacgtggttaatgaatgtattgcggcaggtattactgaaattgtgttggtt
acgcattcatctaaaaactcaatagaaaaccactttgataccagttttgaattggaagcc
atgctggaaaaacgtgtacagcgacagcttttgcaggaagtgcaggctatttgtccggaa
catgtcaccattatgcaagtgcgtcagggattggcaaaaggattgggtcatgctgttctt
tgcgcgcatccattaatcggggatgagccggttgccgtcgttcttccagacgtcattatt
gatgaatatgcctccgatttgaaaaaagataacctgagtgaaatgttgcaacgtttttat
agcaccggccatagccagattatggttgagccggtagaaaatgtgagcagttatggtgtt
gttgattgcaaaggcgtggaattaaaacctggcgacagcgcgccgatggttggcgtggtt
gaaaaaccgaaagcgtccgaagctccgtctaatttggctgttgtcggtcgctatgttttg
tctgcggatatttgggatttgttgaaaaagacccaacctggtgcaggtaatgaaattcag
ctgaccgacgcgattgccatgttgatggaaaaagaaacggtagaggcttatcacctaaaa
ggggtaagtcatgactgcggtaataaactgggatatatgactgcatttgttgagtatgct
atgcgtcacgatgttctgggcgcggatttttcacaatggctgagcgatgccattgaagat
aaagtaaattaa

DBGET integrated database retrieval system